KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ07001_316Help
Entry
ICDCCJ07001_316   CDS       T01372                                 

Definition
(GenBank) anthranilate synthase component II
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
cjn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjn01100  Metabolic pathways
cjn01110  Biosynthesis of secondary metabolites
cjn01130  Biosynthesis of antibiotics
cjn01230  Biosynthesis of amino acids
Module
cjn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ICDCCJ07001_316
Enzymes [BR:cjn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     ICDCCJ07001_316
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ICDCCJ07001_316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Peptidase_C26 Glycos_trans_3N DUF668 SATase_N
Motif
Other DBs
NCBI-ProteinID: ADT65725
Position
320450..322051
Genome map
AA seq 533 aa AA seqDB search
MILLIDNYDSFVFNVKSMLEQLSNDEILVRRNDEISLSEIKNLNPTHIILSPGPKHPSQS
GICLEIFKARLNIPVLGICLGHQALALAFDSLVVKMQEPMHAKNSLIKQCKENELFSNLP
SNFSVMRYHSLEVKQLSDELEILALDEKGVIMALGHKNLPYYGVQFHPESYFSEYGLQLF
SNFLKQDIKKSQKQENPLSFYLQKMSENHFLQSDDFEQICKIIMSKDYEILQVAALLILI
TEKSLNEKSLSAFVRQILRYSQTFSDESEMIDICGTGGDGFKSINVSTTSAFILAALGVK
VAKHGNRAISSSSGSTDVLEALNITTPNTLESALKQLNNQGLSFLHAPFFHPLVGELKEI
RSRLGVRTVFNVLGPLLHPNLKLKYQLMGNYHAPVHRLLIEVLKNLGRKKALVVRGNDGM
DELSICDESKIYELCEGEILEYSICPEQFGFKRAFHSEIIGSSAYENAKDLKDILSGKMQ
GAKFDLVVLNAMFALYTANKASSPLVAKDIILEAIYSGKVIEYFKEYQAYAKA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatacttttaattgataattatgattcttttgtttttaatgttaaaagcatgttagag
caactcagcaatgatgaaattttagtaagaagaaatgatgaaatttctctgagtgaaatt
aaaaatttaaatcctactcatattattttaagtcctggtccaaagcatccaagtcaaagt
gggatttgtcttgaaatttttaaagcaaggcttaatatccctgttttgggcatttgttta
ggacatcaagctttagctttagcttttgattctttagtggttaagatgcaagagcctatg
catgcaaaaaattctttgataaaacaatgcaaggaaaatgaattattttctaatttgcct
tcaaattttagcgtgatgcgttatcattctttagaggttaaacagcttagtgatgagctt
gaaattttagcccttgatgaaaagggtgtgattatggctttgggacataaaaatttacct
tattatggtgtgcaatttcatcctgaaagctattttagtgaatatggcttacagcttttt
tctaattttttaaaacaagatataaaaaaatcacaaaaacaagaaaatcctttaagtttt
tatttgcaaaaaatgagtgaaaatcattttttacaaagcgatgattttgagcaaatttgt
aagattattatgtctaaagattatgaaattttgcaagtggcggctttgttgattttaatc
actgaaaagtctttaaatgaaaaatctttaagtgcttttgtaagacaaattttaagatat
tctcaaacttttagtgatgagagtgagatgattgatatttgtggaacaggtggagatggt
tttaaaagtatcaatgtttctacgactagtgcttttattttagcagctttaggagtaaaa
gtagccaaacacggaaatcgtgccatttcaagttctagcggaagtacagatgtgttagaa
gctttaaatataactactccaaacactttagaatcagctttaaaacaactaaacaatcaa
gggcttagttttttacatgctccatttttccatcctttagtaggagaacttaaagagatc
agatcaaggcttggagtaagaacggtttttaatgttttaggtcctttattgcaccctaat
ttaaagttaaaatatcaacttatgggaaattatcacgcacctgtgcataggcttttgata
gaggttttaaaaaatttaggacgcaaaaaagctttagtggtaagaggaaatgatggtatg
gatgagcttagtatttgcgatgaaagtaaaatttatgagctttgtgaaggagaaatttta
gagtattctatctgtcctgaacaatttggttttaaaagagcttttcatagtgaaatcata
ggatctagtgcatatgaaaacgctaaggatttaaaagatattttaagtggtaaaatgcaa
ggggcaaaatttgatttagtagttttaaatgctatgtttgcactttatacagccaataaa
gcaagttcgcctttagtggctaaagatataattttagaagccatttattcaggtaaagtt
atagagtattttaaggagtatcaagcttatgctaaagcttaa

DBGET integrated database retrieval system