KEGG   Coturnix japonica (Japanese quail): 107305890Help
Entry
107305890         CDS       T04297                                 

Gene name
NLN
Definition
(RefSeq) neurolysin
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjo01002]
    107305890 (NLN)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     107305890 (NLN)
Peptidases and inhibitors [BR:cjo01002]
 Metallo peptidases
  Family M3
   107305890 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 107305890
NCBI-ProteinID: XP_015704018
Position
Z
AA seq 698 aa AA seqDB search
MLALCTARRSIGPRILLRMTLGAEITNQLKASSYIASGRNLLRWDLSPDQIRTRTEELIR
KTKHVYDVVGKLNIEEVTHENTVRALADIEVEYAVERSMLDFPQHVSPDKEVRLASTEAD
KKLSNFDVEMSMREDVFQKIVYLQQTCNLENVKPETKRYLDKSVQVGKRNGLHLPKEVQH
EIMTMKKKLSELCIDFNKNLNEENMFLVFSKEELEGLPDDFIKSLEKTEEDKYKVTLKYP
HYFPVMKKCCISETRRKMESAFNTRCKEENTKILQQLLPLRAKVAELLGYNTHANFVLEV
NTAKSTDNVATFLDDLSKKLKPLVEKEREFILDLKKKECQERNCDYDGRINAWDLHYYMN
KTEELKYSIDQEKLKEYFPIEAVTEGLLNIYQKLLGLVFERVESAHVWHDSVTLYTVKDS
STGETLGQFYLDLYPREGKYGHAACFGLQPGCLLSDGSRMMSVAALVTNFTKPGLDRPSL
LRHDEVKTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMFENWVWEKEPLQQMS
RHYKDESHVADALLEKLAASRLANTGLLTLRQIVLSKVDQALHTKPSVDPGDEYAKYCME
ILGIPATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDIFYSCFKQEGIMNPKAGMKYR
NLILKPGGSLDGMDVLQNFLERKPSQRAFLLSKGLCVQ
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctgtgcaccgctcgcaggtccattgggcctcggattttgttgagaatgaca
ttaggagcagaaatcactaatcagctcaaggcttcttcatacatagcatcaggccgaaac
cttttgagatgggacctgtcaccagatcaaattagaacaagaacagaagaactgatcagg
aagacaaaacatgtatatgatgttgttgggaagcttaatattgaagaagtgacacatgaa
aatactgtacgggccttggcagatatagaagtggaatatgcagtggaaagaagtatgttg
gattttccccagcatgtctcacctgacaaagaggtacgcttagcaagcacagaagctgac
aaaaagctttccaatttcgatgtggagatgagcatgagagaagatgtgtttcagaagatt
gtttatttgcagcaaacctgcaatcttgaaaatgtaaagcctgaaacaaagcggtaccta
gacaaatcagttcaagtgggaaaaagaaatggactccatcttcctaaagaagtgcaacat
gaaataatgacgatgaagaaaaagttaagtgagctgtgtatagacttcaacaaaaacctg
aatgaggaaaatatgtttcttgtattttccaaagaagaacttgaaggcctgcctgatgac
tttattaagagtttagagaagactgaggaggacaaatataaagtaacattaaaatatcct
cactattttcctgttatgaagaagtgctgcatttcagaaaccaggagaaaaatggaatct
gcctttaacacaagatgcaaggaggagaacaccaaaattcttcagcagttgcttccacta
agggcaaaagtagcagagctgcttggttataatacacatgccaactttgttctggaggta
aacactgcaaagagcacagataacgtagcaaccttcttagatgatttgagtaagaagcta
aagccgttggttgagaaggaaagagaattcattctagacttgaagaaaaaggagtgccaa
gagagaaactgtgattatgatggaaggatcaatgcgtgggatcttcattattatatgaac
aaaacagaagagctgaagtactccatagatcaagagaagctgaaagaatacttcccaatt
gaggctgttacagaaggcttattgaatatttaccagaagctgcttggacttgtatttgag
cgagtagaaagtgctcatgtttggcatgacagtgttactctttatacagtaaaggacagt
tcaacgggagaaacattagggcagttctatttggacctttaccctcgagagggaaagtat
gggcatgcagcatgctttggtctccagcctggctgtcttctctctgatggcagcagaatg
atgtctgtagctgctctggtaaccaatttcacaaaaccaggattagatcgtccatcactg
ctgcgacatgatgaagtaaagacatatttccacgagtttggtcacgtaatgcatcagata
tgtgcacagactgattttgccaggtttagtggaactaatgtggaaacggacttcgtagag
gtaccttcacagatgtttgagaactgggtgtgggaaaaagaaccactgcagcaaatgtca
agacattacaaggatgaaagccatgttgcagatgctctccttgagaaattagctgcctct
agactggctaatacaggtcttttaaccctccgccagattgttttgagcaaggttgaccag
gcgctccatacaaagccatctgttgacccaggagatgaatatgccaaatactgtatggag
atcctaggaattcctgcaaccccaggaacaaacatgccagctacctttgggcatctggca
ggtggttatgatggacagtactatgggtacctctggagcgaagtgttttccatggacatc
ttttatagctgctttaagcaagaaggcataatgaatccgaaggccgggatgaaatacaga
aatcttattttgaaacctggaggatccttggatgggatggatgtgcttcagaatttcttg
gagcgtaaaccaagccagagagctttcctactgagtaagggactctgtgttcagtaa

DBGET integrated database retrieval system