KEGG   Coturnix japonica (Japanese quail): 107305956Help
Entry
107305956         CDS       T04297                                 

Gene name
HMGCS1
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00072  Synthesis and degradation of ketone bodies
cjo00280  Valine, leucine and isoleucine degradation
cjo00650  Butanoate metabolism
cjo00900  Terpenoid backbone biosynthesis
cjo01100  Metabolic pathways
cjo03320  PPAR signaling pathway
Module
cjo_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107305956 (HMGCS1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    107305956 (HMGCS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107305956 (HMGCS1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107305956 (HMGCS1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107305956 (HMGCS1)
Enzymes [BR:cjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     107305956 (HMGCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Phage_holin_7_1
Motif
Other DBs
NCBI-GeneID: 107305956
NCBI-ProteinID: XP_015704152
Position
Z
AA seq 539 aa AA seqDB search
MRPRWQAAMGFRSVSATMPGSLPVNTESCWPKDVGIVALEIYFPSQYVDQMELEKYDGVD
AGKYTIGLGQSKMGFCSDREDINSLCLTVVQKLMERNSLSYDCIGRLEVGTETIIDKSKS
VKTVLMQLFEESGNTDVEGIDTTNACYGGTAALFNAINWIESSSWDGRYALVVAGDIAVY
ATGNARPTGGAGAVAMLVGPNAPLIFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQ
CYLSALDRCYSVYRNKIHAQWQKEGTDRRFTLNDFGFMIFHSPYCKLVQKSVARLLLNDF
LSDQNAETSNGVFSGLEAFRDVKLEDTYFDRDVEKAFMKASAELFNQKTKASLLVSNQNG
NMYTPSVYGCLASLLAQYSPEHLAGQRISVFSYGSGFAATLYSIRVTQDATPGSALDKIT
ASLSDLKARLDSRKCIAPDVFAENMKIRQETHHLANYIPQCSVEDLFEGTWYLVRVDEKH
RRTYARRPVMGDGPLEAGVEVVHPGIVHEHIPSPAKKVPRIPATTESEGVTVAISNGEH
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgcgctggcaggcggccatgggcttccgcagcgtatctgccacaatgcctggg
tctcttccagtgaacaccgaatcctgctggcccaaagacgtgggcattgttgctctggaa
atctattttccctctcaatatgtcgaccagatggagctggagaagtatgatggcgtggat
gcaggcaaatacactattgggttaggccagtcaaagatgggcttctgctctgaccgagag
gatatcaattccctctgtttgactgtggttcagaagcttatggagaggaatagcctttcc
tatgactgcattgggagactggaagttggaacggagacaataattgataaatcaaaatcg
gtgaagactgtcctgatgcagctgtttgaagagtcgggcaacactgatgtggagggcatt
gacaccaccaacgcctgctatggaggcactgctgctctctttaatgctattaattggatt
gaatccagttcttgggatggacgttatgcacttgtggttgctggagacattgctgtgtat
gccactggaaacgccaggccaacaggtggagctggtgctgttgcgatgctagttggtcca
aatgctcctttaatttttgagagaggactgcgtggaacccacatgcaacacgcttatgac
ttctataaaccagatatggtctctgaatatcctgtggttgatggcaaactgtctatacag
tgctacctcagtgcattagaccgctgctatagtgtttatcgcaataaaatccatgcccag
tggcaaaaagaggggacagacagacgtttcaccttgaatgactttggattcatgatcttt
cattctccctactgtaaactggtacagaagtctgtggcaaggctgttgctgaatgacttt
ctcagtgaccagaatgcagaaacatcaaatggtgttttcagtggtctggaagctttcagg
gatgtaaagcttgaagatacatattttgacagggatgtggaaaaagcttttatgaaagct
agtgcagagctcttcaatcagaaaaccaaagcttccttacttgtgtccaatcagaatgga
aacatgtacacaccttcagtctacggttgccttgcttctcttctagctcagtactctccg
gagcaccttgcaggacaaagaattagtgtgttctcatacggctctggttttgctgctacg
ctgtattccatcagagttacacaggatgccactcctggttctgcactggacaaaataact
gccagcctttctgatcttaaagcaagacttgactcaagaaaatgcattgcacctgatgtc
tttgcagaaaacatgaagattagacaggagacacatcacttggccaactatattccacag
tgttcagtagaagatctctttgaggggacatggtatcttgtgcgtgtggatgagaagcac
agaagaacatatgcacgacgcccagttatgggtgatggacccctggaggcaggagttgaa
gttgtccacccaggcattgttcatgagcacatcccaagccctgctaagaaagtgccaaga
atccctgcaacaacagagtctgaaggcgttactgttgccatttccaatggggagcattaa

DBGET integrated database retrieval system