KEGG   Coturnix japonica (Japanese quail): 107306468
Entry
107306468         CDS       T04297                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjo01002]
    107306468 (ERAP1)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107306468 (ERAP1)
Peptidases and inhibitors [BR:cjo01002]
 Metallo peptidases
  Family M1
   107306468 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N BLOC1_2
Other DBs
NCBI-GeneID: 107306468
NCBI-ProteinID: XP_015705151
Position
Z
AA seq 933 aa
MTAPRWEVVVLVLVLVLASMGWCVSRTQGGGGSTPFPWDKVRLPRHVVPLHYHLLIHPNL
TTFTFTGTVAIDIAVTQPTKAVVLHSKRLRITRAAIEAGARSTCTVRDVRVLQHPALEQL
ALLAAEPLCAGHNYTVSIQYSANLSDSFSGFYKSTYRTQEGELRVLASTHFEPTSARMAF
PCFDEPAFKARFSIKIRREPNHLALSNMPLVKSMNIASGLVEDHFDTSVKMSTYLVAFIV
SDFKSISKVTSHGVKISIYTVPEKIDQAHYALDAAVKLLDFYEDYFSIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESALLYDPEKSSASSRLWITMIIAHELAHQWFGNLVTMEWWND
LWLNEGFAKFMELLSVNVTHPELGVEDYFLRRCFDAMEVDALNSSHPVSTPVEDPAQILE
MFDEVSYEKGSCILNMLRDFLTADVFKAGLVQYLQKYSYQNTKNEDLWDSLTNICPTVGT
ENSELQGDGFCRRNQQSSSNTHWTKESLDVKAMMDTWTLQKGFPLVTVTVRGRNVHLQQE
HYKKGVDSLSPTENGYLWHIPLTYITSRSHTVERFLMRTKTDVIILPEEAEWVKFNVDMN
GYYIVHYEDDGWDRLINLLRENHTMISSNDRASLINNIFQLVRIKKLPISKAFDLTLYMK
RETQIMPILQGMNELVPIYKLMERRDMDDTEKQLKDYIVSLFKDLIDKQLWSDEGSVSER
MLRQSLLTFACVRRYQPCVDKAEEYFSKWQKSNGTLRLPADVKTAVYVVGAQTSEGWDFL
LSKYQHHSFSVDKDKIASALSLTRNKDKLQWLMDEGLRGDIIKTQDFPYILVSVARNPSG
HHLAWTFLRENWEKLVKKFELGSPSIAGMVTGVTNQYSTRPQLAQVKEFFSSLEEKSAQL
RCIQQAIETIEDNIQWMDRYFEEIKTWLQKNHS
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgacagcgccgcgctgggaggtggtggtgctggtgttggtgctggtgctggcgagcatg
gggtggtgtgtcagccgtacccagggcggcggcggcagcacgccgtttccctgggacaag
gtgaggctccccaggcacgttgtcccgctgcactaccacctcctcatccatcccaacctc
accacgttcaccttcaccggcaccgtggccatcgacatcgcggtcacgcagccaacgaaa
gcggtcgtcctacatagcaaacgcctgcgcatcaccagggctgccatcgaggcgggggca
aggagtacctgcacggtgcgggacgtgagggtgctgcagcaccctgccctcgagcagctg
gcactgctggccgccgagccgctgtgcgccgggcacaactacaccgtcagcatccagtac
tcggcgaacctctccgactccttttccggcttctataaaagcacttacagaacccaggaa
ggagaactcagagtgcttgcatcaactcattttgagcctacatctgcaagaatggccttc
ccatgttttgacgaaccagccttcaaagccaggttttcaattaaaattagaagggaacca
aatcaccttgcattgtccaatatgcctctggtgaagtccatgaatatagcttcagggctt
gttgaggaccattttgataccagcgtcaagatgagtacttacctcgtggcctttattgtt
tcagattttaagtccatcagcaaagtaaccagtcacggagttaagatttccatatacaca
gtaccagaaaagatcgaccaggctcattatgcactggatgcagcagtaaaacttctagac
ttttacgaggactacttcagcattccctaccccttacctaaacaagatttagcagctatt
cctgattttcagtctggtgctatggaaaactgggggttgaccacataccgggaatctgca
ttgctatatgatcctgaaaagtcttcagcatcctctaggctttggattactatgataata
gcccatgagctggctcaccagtggtttggcaacctcgttaccatggagtggtggaatgat
ctgtggttaaatgaagggtttgcaaagtttatggaactcctgtcagtaaacgttacccat
ccagaactgggagttgaagattatttcttaagaagatgttttgatgccatggaagtggat
gccttaaattcatcccatcctgtgtctactcctgtggaggatccagctcagattttagaa
atgtttgatgaagtttcatatgagaagggatcatgtatattaaacatgctgagggacttc
ctgactgcggatgtgtttaaggctggactggtgcagtatctacagaaatacagctatcag
aatactaagaatgaagatttgtgggacagtttaacaaatatttgtcccacagtaggtact
gaaaacagtgaactacagggtgacggcttttgcagaagaaaccagcagtcatcttcaaat
acacactggaccaaagagtccctagatgtgaaggcaatgatggacacttggacactacaa
aaaggtttccccctggtaactgtcaccgtgagaggaaggaacgtccacttgcagcaggag
cactacaagaaaggagtggattctctttcacccacagaaaatgggtacttgtggcacatt
ccactaacttacattaccagcagatctcatactgttgaaagatttttgatgagaaccaaa
acagatgtcattatccttccagaagaagctgaatgggttaaattcaatgtggacatgaat
ggttattacattgtgcactatgaagatgatggatgggatcgtctgatcaaccttttgaga
gagaaccatacaatgattagcagcaatgacagagcaagtctcattaacaatatattccag
cttgtgagaataaaaaaactgccaatttccaaagcttttgatttaactttatacatgaaa
cgagaaacacagatcatgcccatactccaaggtatgaatgagctggttcctatatacaag
ctcatggagcggagagatatggatgacacagaaaaacagttaaaggactatatagtcagt
ctatttaaggacctaattgacaagcagctttggagtgatgaaggctcagtgtctgagaga
atgcttcggcagtccctgctgacatttgcatgtgtgcgcaggtaccagccctgcgtggac
aaagcggaagagtatttttcaaaatggcagaaatccaatggaaccttaaggctgccagca
gatgtgaagacagcagtgtatgtcgttggagcacaaacatctgaaggttgggatttcctc
cttagtaaataccagcaccactccttcagtgtagacaaagataaaattgcatcagctctc
agcctcaccaggaataaggacaaacttcagtggctaatggatgaaggtctgcgtggtgac
atcataaaaactcaggattttccatacattcttgtgtctgttgccagaaatccatctggc
caccatcttgcttggaccttcttaagggaaaactgggaaaaactcgtcaaaaaatttgaa
cttggttcgccatccatagcaggcatggtcactggagtgacaaatcagtactcaacaagg
ccacagcttgcacaggtaaaagaattcttcagttctctggaggaaaaaagtgcacagctt
cgttgtatccagcaagccattgaaaccattgaggacaacatacaatggatggatagatat
tttgaggaaatcaaaacgtggctgcaaaagaaccactcctaa

DBGET integrated database retrieval system