KEGG   Coturnix japonica (Japanese quail): 107306869Help
Entry
107306869         CDS       T04297                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107306869 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjo01001]
    107306869 (MAP4K4)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107306869 (MAP4K4)
Protein kinases [BR:cjo01001]
 Serine/threonine kinases: STE group
  STE20 family
   107306869 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 107306869
NCBI-ProteinID: XP_015705784
Position
1
AA seq 1301 aa AA seqDB search
MANDSPAKSLVDIDLSSLRGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNI
ATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLA
HLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIAC
DENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKF
FSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYE
YSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLR
EQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREQEARRQQEREQRRREQEEKRRLEEME
RRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEILQQQLLQEQAMLLEYRWREME
EHRQAERLQRQLQQEQAYLLSLQHDHRRQQQQQQQQQQQQQQQQQQQQERNKQSYHAPEP
KSHYEPAERAREVEERFRKTNQGSPEAQSKQMGKVLEPPVPSRSESFSNGNSEPAQPALQ
RPMEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPYPPSRSEVLNQSSDS
KSEVPDPTQKAWARSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNNQAGQRNSTSN
IEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRMRSSSKSEGSPSQ
RHESAPKKPEEKKEVFRPIKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEED
DDMEQEGADESTSGPDDVRAVSTLNLSNGETESVKTMIVHDDVESEPALTPSKEGTLIVR
QTQSASNTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSSEAMRSEAIRQDPTRK
GSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKV
YPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG
DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTV
EEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYE
DEGVYVNTYGRITKDVVLQWGEMPTSVAYIQSNQIMGWGEKAIEIRSVETGHLDGVFMHK
RAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgattctcctgcaaaaagtctggtggacatcgacctttcctccctgcggggt
cgacatgtcaaaacaggccagttggcagccatcaaagtcatggacgttactgaggatgaa
gaagaagaaatcaaactggagattaatatgcttaagaaatattctcatcatagaaacatt
gcaacgtattatggtgctttcattaagaaaagtcctccaggacatgacgaccaactgtgg
cttgttatggagttttgtggagcaggctctatcacagaccttgtgaagaacacgaaaggg
aatactctgaaagaagactggatagcatacatctccagagagattctcagggggctggca
catcttcatgcccaccatgtgattcacagggatatcaaagggcaaaatgtgttgttaaca
gagaatgcagaagtgaaacttgtggatttcggtgtgagcgctcagctggacaggacagtt
ggcaggagaaacactttcattggaactccatactggatggctccagaagttattgcctgt
gatgaaaatccagatgctacgtatgattacagaagtgacctctggtcctgcggcattaca
gccatagaaatggcagaaggagctcccccactctgtgacatgcatcccatgagggcactc
tttctgatacccagaaaccctccgccacggttaaaatccaagaaatggtcgaaaaagttt
ttcagctttatagaaggttgtctagtgaagaattacatgcagcgaccttctacagagcaa
ctactgaaacatccatttatacgtgaccaaccaaatgaaagacaagtccgaatccagctt
aaggaccatatagacaggaccaggaagaagagaggagagaaagatgagacagagtatgaa
tatagtggaagtgaggaagaagaggaggaagtgcctgaacaagaaggagagccaagttcc
attgtcaatgtgcctggagagtcaaccctccgacgtgatttcctgaggctgcagcaggaa
aacaaggaacgatccgaagcccttcggagacagcagctgctgcaggagcagcagctccgt
gagcaggaggagtacaagaggcagctactggcagagagacagaaacgcattgagcagcag
aaggagcaaaggagacggctggaagagcaacaaagaagagaacaggaagctcgcaggcaa
caagagcgtgagcaaaggcggagggaacaggaagaaaaaagacgtctggaagaaatggag
aggagacgtaaggaagaggaagagagaagaagagcagaggaggaaaagaggagggtagaa
agagagcaggagtatatcaggcgacagctagaagaggagcagcggcacttggaaattcta
cagcagcagctgctccaggagcaggccatgttactggaatacagatggcgggagatggag
gagcatcgacaggcagagcggctccaacgccagttgcagcaggagcaagcctacctcctg
tcactgcagcatgatcacaggcggcagcagcagcagcagcagcagcagcagcaacaacag
cagcagcaacagcagcagcagcaggaaagaaataaacaaagctatcatgcccctgagcca
aaatcccactatgaacctgctgaaagagcgcgtgaggtggaggagagatttagaaaaact
aatcagggctcccctgaagcacagtctaagcagatgggcaaagtgttggagccaccagtg
ccttcaagatcagagtccttttccaatggaaactcagaacctgctcagcctgccctgcag
aggccaatggagccccaagtacagtggtcccatctggcatctctcaagaacaatgtttcc
cctgtctcgcgatcccattccttcagtgacccttctcccaaatttgctcatcaccatctt
cgttcccaggacccatatccaccttcacgcagtgaagtgctaaatcagagttctgactct
aagtcggaggtacccgaccccacccaaaaggcttgggctagatcagacagtgacgaggtg
cctccaagggtacctgtgagaacaacatcccgatcaccagtcctgtcccgtcgtgattct
ccactgcagggcagtgggcagcaaaataaccaagcaggtcaaagaaactccacgagcaat
atagagcctcgtctgctgtgggaaagggtggagaagctcgtaccaaggccaggcagtggc
agttcttcgggttcaagcaactctggctcacagcctggttcccaccctggctctcagagt
gggtctggagagcggttccggatgagatcatcatccaaatcagagggttcaccatcgcag
cgtcatgaaagtgcacctaaaaagcctgaagagaaaaaggaggtcttcagacctatcaag
cctgctgatttaactgcattggcaaaggagctgcgagcagtagaggatgtgcgacctcca
cataaagtgacggattattcatcctcaagtgaggagtcagggacgacagatgaagaagat
gatgatatggaacaagaaggagcagatgaatctacttctggaccagatgatgtccgagca
gtgtcaacactgaacttgagcaatggtgaaacagagtctgtaaaaactatgattgtccat
gatgatgtggagagtgaacctgccttgactccttctaaggagggcaccttaattgtccga
cagactcagtccgctagtaacacactccagaaacacaaatcttcctcctcctttacacct
tttatagaccccagattactacagatttctccatctagtgggacaactgtgacttcagtg
gtaggattttctagtgaagcaatgaggtcagaggcaataaggcaagaccctacacggaaa
ggctctgttgtcaacgtgaatcctacaaacacacgaccacagagtgataccccagagatc
cgcaaatacaagaagagattcaattctgagatactatgtgctgccttatggggagtgaac
ctgttagtgggcacagaaagtggtctgatgctgctagacagaagtggtcaggggaaggtt
tatccgctcatcaatcgaagaagattccagcaaatggatgtacttgaagggctgaatgtc
ttggtgacaatttctggtaagaagaacaagttgcgagtttactatttgtcctggttgagg
aataaaatccttcacaatgatcccgaagtggaaaagaaacagggttggacaacggtgggt
gacttggaaggctgtgtgcactataaagttgtaaaatatgaaagaatcaaattcttggta
attgcattgaagagctctgtggaagtctatgcatgggcgccaaagccataccacaaattt
atggcctttaagtcatttggtgaattggtacataagccattgctggtggatctaactgta
gaagagggtcagagactaaaagtcatttatggctcctgtgctggcttccatgctgttgac
gtggattcaggatcagtctacgatatttatctaccaacacatatccagagcagtatccaa
cctcacgcaatcataattctcccaaatacggatggaatggagctactggtctgctatgag
gatgaaggagtttatgtaaacacatatggaaggatcaccaaggatgtggttctacagtgg
ggagaaatgccaacttcagttgcatatattcaatccaatcagataatgggctggggagag
aaagctattgaaattcggtcagtggagacaggacatttggacggagtgtttatgcacaaa
agggcacaaagactcaagttcttatgtgaacgcaatgacaaggttttctttgcctccgta
cggtcgggtggaagcagtcaagtttatttcatgacccttggcaggacttctcttctgagc
tggtag

DBGET integrated database retrieval system