KEGG   Coturnix japonica (Japanese quail): 107308400Help
Entry
107308400         CDS       T04297                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjo01002]
    107308400
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     107308400
Peptidases [BR:cjo01002]
 Metallo Peptidases
  Family M10
   107308400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 DUF4953 Reprolysin_5 Reprolysin_4 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 107308400
NCBI-ProteinID: XP_015707754
Position
1
AA seq 500 aa AA seqDB search
MELKMLAFLGLLCISCSYALPVAPETENEDMQFARKYLENFYDFKEDKSSLFKSTNLNHM
ADKIREMQSFFGLEVTGELNRKTMDMMKQPRCGIPDVRSYTTFPQNPRWNKEDVTYRIWN
YTPDMLQADVDEAIARAFQLWSSVTPLRFTRLYSGEADIMISFASGFHRDFYPFDGPGGT
LAHAYPPNSGIGGDAHFDEDENWTKFTTYSGYNLFLVAAHELGHSLGLGHSNVFGALMYP
IYMAKDTRNYRLHQDDINGIQALYGQPRESPLFPTKAFPPQEPTEMAPTEAPTQISPWEE
PTEMAPTERPEDCDPHLTFDAITTLRGEILFFKGSYVWRKSPYFSEIEHDTISTFWPSLA
AGFDAAYEIDKKDRVIFFKDNQYWAVSGYKIEPGFPKPIQNLGFPRSVRKIDAAVHDQNT
KKTYIFVGNKYWSFDENTQSMERGYPRKIAADFHGIGHTVDAALQNNGHFYFFHGSNQYE
VDIKNKKFVRKMKSNSWFDC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaagatgcttgctttcctggggttactgtgcatttcatgctcttatgctttg
ccagtggctccagaaactgaaaatgaagatatgcaatttgctcggaaatatctggaaaac
ttctatgattttaaggaagataaaagttctctatttaaatcaacgaatctcaaccacatg
gctgacaaaatccgagaaatgcagtcgttctttgggctggaggtgaccggggagctgaac
cgtaagacgatggacatgatgaagcagcccagatgtggaatcccagacgtccgctcatac
accaccttcccacagaaccctaggtggaataaggaagatgtgacatataggatttggaat
tacactcctgacatgctgcaagctgatgtggacgaagcgattgcaagagccttccagctc
tggagcagcgtcacccctttgaggttcaccaggctctacagtggtgaagcagacataatg
atctcctttgcttctggatttcatcgtgacttctatccctttgatggtccaggaggaacg
ctggctcatgcctatccccccaacagtgggataggaggagatgcccactttgatgaagat
gaaaactggaccaagtttaccacctatagtgggtacaatttatttcttgttgctgctcat
gagttgggtcactcactgggtcttggtcattccaatgtctttggtgccttgatgtatccc
atatatatggccaaggatacaagaaactacaggcttcatcaggatgatatcaatggcatt
caggccctctatggacaaccgagggaatcccctctatttccaacaaaagcatttccccca
caagaaccaacggaaatggcacctacagaagcaccaactcaaatttcaccctgggaagaa
ccaacagaaatggcacccacagaaagaccagaggactgtgaccctcatttgacttttgat
gctatcactactctccgtggggaaattctgttcttcaaaggcagctacgtctggcgcaaa
agtccctacttctcagaaatcgagcatgacaccatctccacattctggccatcactggca
gctggatttgacgctgcttatgagattgacaagaaggatcgagtgatcttttttaaagat
aaccagtactgggctgtcagcggctacaaaatagagccaggtttccccaaacctattcag
aacctgggctttcccagaagcgttaggaaaatagatgctgctgttcatgatcaaaatacc
aagaaaacctatatctttgtaggcaacaagtactggagttttgatgaaaatacccaatca
atggaaagaggatatccaaggaaaatagcagctgacttccacggaattggccacactgtt
gatgctgcccttcaaaacaacggacatttctactttttccatggatcaaaccagtatgag
gttgacatcaagaacaagaaatttgtccgtaaaatgaagagcaacagctggtttgattgc
tag

DBGET integrated database retrieval system