KEGG   Coturnix japonica (Japanese quail): 107308862Help
Entry
107308862         CDS       T04297                                 

Gene name
ACVR2B
Definition
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04060  Cytokine-cytokine receptor interaction
cjo04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107308862 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107308862 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjo01001]
    107308862 (ACVR2B)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107308862 (ACVR2B)
Protein kinases [BR:cjo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107308862 (ACVR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 107308862
NCBI-ProteinID: XP_015708525
Position
2
AA seq 512 aa AA seqDB search
MSASWLTLAVLCATLGAGPGHGEAETRECIYYNANWELEKTNQSGVERCEGEKDKRLHCY
ASWRNNSGSIELVKKGCWLDDFNCYDRQECVATEENPQVFFCCCEGNYCNEKFTHLPEVT
GPEVIYEPPPPTPSLLNILVYSLLPIAVLSVAILLAFWMYRHRKPPYGHVDINEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDYVAVKIFPIQDKQSWQSEREIFNTPGMK
HENLLQFIAAEKRGTNLETELWLITAFHDKGSLTDYLKGNIISWNELCHVAETMARGLSY
LHEDVPWCKGEGHKPAIAHRDFKSKNVLLKNDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCRAVDGPVDEYMLPFEEEIGQ
HPSLEDLQEVVVHKKMRPVFKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERIAQ
IRKSVNGTTSDCLVSIVTSVTNVDLPPKESSI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttcgtggctgactttggccgtgctctgtgcaactttgggcgcaggaccaggt
cacggggaggcagagacaagggaatgcatttactacaacgccaactgggagctggagaag
accaaccagagtggtgtggagcgctgcgagggggagaaggacaagcggctccactgctac
gcctcctggagaaacaactcgggatccattgagctggtgaagaaaggctgctggttagat
gacttcaactgttatgacaggcaggagtgcgtagccacagaagaaaaccctcaagtgttt
ttctgctgctgcgagggcaactactgcaatgagaaattcacccacttgcctgaagtaacc
ggcccagaagtcatatatgagcctccaccaccaacaccctctctgcttaacatcctggtg
tactctctgctgcccatcgctgtcctgtcagtggccatcctcttggccttctggatgtat
cggcaccgcaagcctccctacgggcacgtcgatatcaatgaggaccccggcccaccacct
ccttctcctttggttggcctaaaacctttacagctcctggagatcaaagccaggggacgc
ttcggctgcgtgtggaaggctcagctgatgaatgactacgtagcagtgaaaatcttccca
attcaggataagcaatcttggcagagtgagagggagattttcaatactcctggcatgaag
catgaaaaccttttgcaatttatcgcagcagagaaaagaggaacaaacctagagacagag
ctctggctgatcacagcattccacgacaagggctctctcacggattacctgaagggcaat
atcatcagctggaacgagctctgccatgttgcagaaaccatggcccgtggcttgtcttac
ctccatgaggacgtcccatggtgcaagggtgaaggacacaaacctgctatagcacacagg
gacttcaagagtaaaaacgtcttgctgaagaacgacctaacagcagtgctagctgatttt
ggtcttgctgtacggtttgaacctggaaaacctccaggggacactcatggacaggtggga
acaaggaggtatatggctcctgaagtgttagagggagcaatcaacttccaacgagacgcc
ttcctgagaatagacatgtacgcaatgggactggtattgtgggagttagtctccagatgt
agagcagttgatggtccagtggatgaatacatgctgccttttgaagaagaaataggtcag
cacccatcccttgaggacctacaagaagtggtcgttcacaagaagatgcgccccgtcttc
aaggatcactggctgaaacaccctggcttggcgcagctctgcgtgaccattgaagagtgc
tgggaccacgacgcagaggctcggctctcagcaggctgtgtcgaggagcgcattgctcag
atccgcaaatccgtaaacggcactacctcggactgccttgtctccatcgtgacgtccgtc
accaacgtggacttgccacccaaagagtccagtatctaa

DBGET integrated database retrieval system