KEGG   Coturnix japonica (Japanese quail): 107309296Help
Entry
107309296         CDS       T04297                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04060  Cytokine-cytokine receptor interaction
cjo04068  FoxO signaling pathway
cjo04144  Endocytosis
cjo04218  Cellular senescence
cjo04350  TGF-beta signaling pathway
cjo04520  Adherens junction
cjo04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107309296 (TGFBR2)
   04350 TGF-beta signaling pathway
    107309296 (TGFBR2)
   04068 FoxO signaling pathway
    107309296 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107309296 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107309296 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    107309296 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107309296 (TGFBR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107309296 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjo01001]
    107309296 (TGFBR2)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107309296 (TGFBR2)
Protein kinases [BR:cjo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107309296 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Pkinase_fungal APH FixQ Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107309296
NCBI-ProteinID: XP_015709464
Position
2
AA seq 556 aa AA seqDB search
MPPRLRPLLLRVSLWVLVGSSSPALLRDRSKENGLQLPRLCKFCDIKATTCSNQYQCKSN
CNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSERCVMKEKKDDG
GLMFMCSCTGEECNDVLFFSEDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRTH
KKRKLNKAWEKNVKPRKHKDCSDVCAIMLDDDHSDISSTCANNINHNTELLPIELDIVVG
KGRFAEVYKAKLKQNTSEQYETVAVKIFPYEEYASWKTEKDIFSDVNLKHENILQFLTAE
ERKTDLGKQYWLITAFHARGNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGRP
KTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVLE
SRMNLENMESFKQTDVYSMALVLWEMTSRCNGVGEVKEYEPPFGSKVREHPCVESMKDNV
LRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTAQCVAERFSEFKHHDKLSGRS
CSEEKIPEDGSVTTAK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgcgcctgcggccgctgctcctgcgcgtatctctatgggtcctcgtgggctct
tcgagccccgcgctgctccgcgatagaagcaaggaaaatggactgcaattgcccagacta
tgcaaattctgtgacattaaagcaacaacgtgctcaaaccaatatcagtgcaagagcaac
tgcaacatcacttctatctgtgagaagaataacgaagtctgtgcagcagtatggagacgg
aatgatgaaaatgtgacactagaaaccatctgccatgatccccagaaaaggctgtatggt
cacatgttggacgactccagctcagagcggtgtgtgatgaaggaaaagaaggacgatggg
ggactgatgttcatgtgttcctgtacgggtgaagagtgcaacgatgttctttttttttct
gaagatccccataagccagaggagaaagatgaaatttccaaagtcacaatcataagtctt
gtccccttattggtgatttctgttgctgtaattgttatcttttatgcttaccgtactcat
aagaagaggaagctcaacaaggcctgggagaagaatgttaagcccaggaaacataaagac
tgcagtgatgtttgtgccattatgttggatgatgaccactcagacatcagctccacctgt
gccaacaacatcaaccacaacacagaattgctgcccattgagctggacattgttgtgggt
aaaggaaggtttgctgaggtgtataaagccaaattgaagcaaaacacatcagagcagtac
gaaactgtggcagtaaagatcttcccctatgaagagtatgcctcctggaaaactgagaaa
gacattttttcagatgtaaatcttaagcatgagaacatcctccaatttttgactgcagag
gagcgtaagacggatcttggtaaacaatattggttgatcactgccttccatgctagagga
aacttgcaggaatacctcacacggcacattatcagctgggaagacctctggaagctggga
ggatccttggcccgagggattgcccatctgcacagtgatcacacaccctgtggtcgccct
aaaacccctattgtgcacagagacctaaagagttccaacatcctggtgaaaaatgattta
acttgctgtctctgtgactttgggttatccctgaggctggacccttctctctctgtggat
gacttggccaacagtggtcaggttggcacagcgaggtacatggcccctgaggttctggag
tccaggatgaaccttgagaacatggagtcctttaaacaaacagatgtgtactccatggct
ttggtcctctgggaaatgacatctcgctgtaatggtgtcggagaagtgaaagagtatgag
cccccatttggctctaaagtgcgagaacatccctgcgtggaaagcatgaaggataatgtc
ctgagagacagagggagacccgagatccccagctcctggcttaaccatcagggcatccag
atggtgtgtgagacccttatcgagtgctgggaccacgaccccgaggctcggctcacagca
cagtgtgtggcagagcgcttcagtgagtttaagcaccacgacaagctctcagggagaagc
tgttcagaggagaagatccccgaggatggctctgtgaccaccgccaagtag

DBGET integrated database retrieval system