KEGG   Coturnix japonica (Japanese quail): 107309925
Entry
107309925         CDS       T04297                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjo03000]
    107309925 (AHRR)
Transcription factors [BR:cjo03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107309925 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5
Other DBs
NCBI-GeneID: 107309925
NCBI-ProteinID: XP_015710590
Position
2
AA seq 889 aa
MGTAAGTQQGSRGPAERSSNQRGSPVPTRGPDRPPSSGAAAAPSAAVGPRGCGLGIACER
GAVGSPCHSAANPPPGSRGVRRPSILPTPGALRPRRGAAPPPRHRRRSSTAPLRTAPAKL
CTPTGGRDAGIKTMIPPGECLYAGRKRRKPIQKQRPAAGNEKSNPSKRHRDRLNAELDHL
ASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQSIKEDNVSNKTAV
QEGGLLLESLNGFALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCR
QLHWAMNPPQMSGQQLQTETGEEYILSKLFKAQENDSTTTDYSSFLTRCFICRVRCLLDS
TSGFLTMQFQGKLKFLFGQRKKSSSGAVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAK
HKADDAAVNTNSSSKGNSSLCEAAELYGRNSHHEGAAFANVLQITENQFKAKNNGENGIS
LVKVQTNEDHWVWVQANAQLLYRSGCSEYVVAQQQMLKEEDEQLKLPNTFAGLKGNLEGL
SYNSALETLGQLKHLNWTAVKNEQDNVKVKFEPHTNGECFVQEESLTSNTPVLGIQNNCT
TNSSWTFRNSGSCSINQRMNACSSRRAGSFYNRDQSFLNLASTCPSHWGSAENCQSYSGL
QQRAMENYTADHLKLQRSLISSESLYDAAFPLDMPIKTEYDSDSENIADNYLMPQNRAWL
DENGTMRKQLFSYPNRVHLKAEPDLCQQASPCQKPRHCLYTPHNWQCIVANHPSNLNLNR
SCKGLRNREVAPFCPQNSSACLESLPDLPHTEGYNQFYSPAPGDKEQNNEVFKMPCEFKS
PCLVQAIKREPLDSPPLSNSGQNRAHMSFPENTIAGPVPHKATECTFLQ
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgggaaccgctgccgggacgcagcaggggagccgagggccggccgagcgcagcagcaac
cagcgcggcagccccgtcccgactcgcggccccgaccggccgccctcctccggtgccgcc
gcagcgccctctgccgccgtagggccgcgaggctgcgggctggggatcgcgtgcgagcgc
ggagccgtcggctcgccgtgtcactccgccgccaacccgccacctggatcacgaggcgtg
cggcggccgagcatcctccccacccccggcgccctccggccccgccgcggcgccgcacct
ccgccccggcaccgccgccgctcctcgaccgctccgctccgcaccgctccggccaaactt
tgcaccccgaccggcggcagggacgcgggcatcaaaacaatgattcctccgggggaatgc
ctctatgctgggaggaaaaggaggaaacccattcagaaacaaaggcctgcagctggaaat
gaaaaatccaatccttcaaagaggcacagggaccgcctaaatgcagagctagaccatctg
gccagcctcctgcctttcccacccgacataatatccaagctggacaagctgtctgtgctg
cgcctcagtgtcagctacctgcgagtcaaaagtttctttcaagccattcaagaaaagcac
tttaagaagcaagttggtcagtcaataaaggaagacaatgtatctaacaagactgctgtc
caagaaggtggacttctgctagagtcactgaacggttttgcattggtggtgagtgcagat
ggaatgatattttatgcatcatcaaccattgtggactacctagggtttcatcagactgat
gtaatgcaccaaaacatatatgattacattcacgttgacgatcgccaggatttctgtaga
caactgcactgggccatgaatccacctcagatgtctggacagcaactacagacagaaaca
ggagaagaatatattctcagtaaattgtttaaagcacaagagaatgacagcacaacaaca
gattattcttccttcttaactcgttgtttcatctgtcgagttcgctgcttgttggacagc
acttctggcttccttacaatgcagtttcaaggcaaactcaagtttctttttggacaaagg
aagaagtcctcatcaggagcagtattaccacctcagctgtccttattctgcatagtggta
ccacttcttctcccttctgtgacagagatgaagatgaaaagcctacttgtgaaagcaaaa
cacaaagctgatgatgcagcagtgaatacaaactccagttccaaaggtaattcaagtctg
tgtgaagcagcagaattatatggaagaaatagtcatcacgaaggtgcagcttttgctaat
gtattacagattactgaaaaccagttcaaagcgaagaataatggagaaaatggcatttct
ctagtcaaagtacaaacaaatgaagatcactgggtctgggttcaagctaacgctcaactt
ctgtatcgaagtggttgttcagaatatgttgttgcccaacagcaaatgctgaaggaagaa
gatgaacaactgaagctacccaacacttttgctggtttgaagggaaacctggagggactt
tcctacaacagcgcccttgaaaccctgggccaactgaagcatctcaactggacagcagtt
aagaatgagcaagataatgtaaaagtgaagtttgagcctcatacaaatggtgagtgtttt
gtgcaggaggaatcactcacttctaacacgccagttttaggcattcaaaacaactgcacc
acaaacagtagctggactttcagaaactcaggctcttgttctataaatcagcgaatgaat
gcgtgttcaagcagaagagctggatcattctacaacagagaccagagtttcttaaattta
gcatcaacttgtccttctcactggggtagtgcagaaaactgtcagtcttactcaggctta
caacagcgtgccatggagaactatactgcagaccacctgaaactgcagagatcgctaata
tcctcggagtctctctatgatgcagcgtttcccttggatatgcctattaaaacagaatat
gattctgattctgagaacattgctgataattacctgatgccacaaaaccgagcctggctg
gatgagaatggcaccatgaggaagcagttgttcagctatcccaatagggtgcacctgaaa
gcagaaccggacctctgtcagcaagcttcaccttgccagaagccaaggcactgcctttat
acgccacataattggcagtgcattgtagcaaatcatcccagcaacctcaatctgaacaga
tcttgcaagggtttgcgtaacagagaggtggccccgttttgcccccagaactcctctgcc
tgcttggaaagcctgcctgacctgccgcacaccgagggctacaaccagttctacagccct
gctccaggggacaaggagcaaaataatgaggtgtttaaaatgccgtgtgaatttaagagc
ccttgcttggttcaagcaatcaagcgtgagcccctggattccccaccgttgtctaacagt
ggacagaacagagcacacatgagctttcctgaaaatacaatagcaggtcctgtgcctcat
aaagccactgaatgtacattcttacagtag

DBGET integrated database retrieval system