KEGG   Coturnix japonica (Japanese quail): 107311741Help
Entry
107311741         CDS       T04297                                 

Gene name
ENPP1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00230  Purine metabolism
cjo00240  Pyrimidine metabolism
cjo00500  Starch and sucrose metabolism
cjo00740  Riboflavin metabolism
cjo00760  Nicotinate and nicotinamide metabolism
cjo00770  Pantothenate and CoA biosynthesis
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107311741 (ENPP1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107311741 (ENPP1)
   00240 Pyrimidine metabolism
    107311741 (ENPP1)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    107311741 (ENPP1)
   00760 Nicotinate and nicotinamide metabolism
    107311741 (ENPP1)
   00770 Pantothenate and CoA biosynthesis
    107311741 (ENPP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjo04090]
    107311741 (ENPP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjo00537]
    107311741 (ENPP1)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     107311741 (ENPP1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     107311741 (ENPP1)
CD molecules [BR:cjo04090]
 Proteins
  107311741 (ENPP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjo00537]
 Enzymes
  107311741 (ENPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase
Motif
Other DBs
NCBI-GeneID: 107311741
NCBI-ProteinID: XP_015714037
Position
3
AA seq 982 aa AA seqDB search
MRRARREAVRPRKTRAGNGAVPAACAPASAPAQLGPASVGVGAAGGSAPGGAGLSKPGRS
XLLITASGNAEGRAAGSMQGNGEKAAGNGRQEGLGGKGAADGELQAAAVPMLPALEVAEE
PEKAPGGKSKDPNTYKVLSLILCVCVLTTILGCIFGLKPSCSKDVKTCKGRCFERTFGSC
RCDRDCVKLGNCCLDYQETCIQPAHIWTCNKFRCGEKRRPEYHCSCSDDCVENNDCCVNY
QAACKGEASWVEEECEDITEPQCPKGFNKSPVLLFSLDGFRAEYLQTWGGLLPVISKLQK
CGTYTSSMRPVYPSKTFPNHYSIVTGLYPESHGIIDNKMYDLKRNAYFTLKSEEKFNPEW
YQGEPIWLTAMYQGLKAGTFFWPGSDVAVDGTFPDLYKEYNSSIPFEERVVTVLRWLQLP
EDERPHFYTLYLEEPDSSGHKFGPVSSGVILALQRVDAIVGMLMDGLKQMNLHKCLNIIF
ISDHGMEAGSCRKTAYLDSYLDNVEDFLLVPGPAARLRPNKVPDEYFSFNYEGIVRNLTC
IEPNQPFKAYMKQFLPKRFHYANNDRIEPLHFYLNSQWQLARKPLEIKSCTGGFHGSDNR
FPNMQAIFIGFGPGFKFQTQVDPFENIEVYNLMCDLLDLKPAPNNGTHGRLNNLLRNPVY
IPHHPKETSHPSECSFVGQRTFPVSLGCSCRTAGLPVRDFHQRLNLTETEVKKTETLTLP
YGRPRVLQKKHNYCVLYHNRYVNGYSKDYKMSLWSAYTVNKNDSWISTTEDISSCLRKDV
RVPSNHNQTCSFYNNHPRLTYGFLSPPNFMKSHYDALLTSNIVPMYPAFKVLWNYFHQSL
LPEYAADRNGVNVVSGPVFDYDSDGIYDNPEKVKRHPGNSEVPIPTHFFIVLTTCKNTSE
TPLKCEGSLDALSFIVPHREDNSESCADGRSESLWVEERMKFHIARVRDIELLTGLSFYQ
DRKQPVSDILELKTYLPTFETV
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgcccgcagagaggcggtcaggccccgcaagacgagggcgggcaacggggcc
gtgcctgcggcctgcgcccccgcctcggccccggcccagctcggccccgccagcgtggga
gtgggggctgccggcggcagcgctccgggaggggcggggctgtccaagccgggccggtcg
nggctattaataacggcgtccgggaacgcggagggcagagcggcgggcagcatgcagggc
aacggggagaaggcggcgggcaacggccgccaggagggcctcggagggaaaggggcggcc
gacggcgagctgcaggctgcggccgtgcctatgctgccggccctggaggtggccgaggag
ccggagaaagctccgggcggcaaaagcaaggatcccaacacctacaaagtgctctctctg
atactctgtgtctgcgtgttaacgacaatcctaggatgtatatttggcctgaagccgagc
tgttcaaaagatgtgaaaacctgcaaaggtcgttgctttgaaaggacctttggaagctgt
cgttgtgacagagattgtgttaagcttggaaactgctgcttagattaccaggaaacatgc
atacagccagctcatatatggacatgtaataagttcaggtgtggagagaagaggcgacca
gaatatcattgctcctgctcagatgattgtgtggaaaataatgattgctgtgtcaattat
caagctgcgtgcaaaggagaggcaagctgggttgaagaagagtgtgaggacattactgaa
cctcagtgtccaaaaggatttaacaaatctccggtgttactgttttcgttggatggcttc
agagcagaatatttgcagacgtggggtggacttctacctgttattagcaaattacaaaaa
tgtggaacatatacttccagtatgagaccagtgtatccttcaaaaacctttcccaatcac
tactccattgtcacaggactgtatcctgaatctcatggtataattgataacaagatgtat
gacctcaaaagaaatgcatacttcacccttaaaagtgaagagaagtttaatccagagtgg
taccaaggagagcctatctggctaacagctatgtaccaaggtctaaaagctggtacgttc
ttctggcctggatcagatgtagcagttgatgggacttttccagatctgtataaagaatac
aatagctcaatcccctttgaagaaagggtggtaactgttcttcgctggctgcagttacct
gaagatgaaagaccacacttttacactctgtatttagaagaaccagattcctcaggccat
aagtttggaccagtaagcagtggagtcattttggcattgcagagagtagatgctatagtt
gggatgctgatggatggtctcaaacagatgaacttgcataaatgcctgaatattattttt
atatcagatcatgggatggaagcagggagctgtagaaaaacagcgtatctggacagctac
ctggacaatgttgaagatttcctgttagtacctggtcctgcagctcgccttcgacctaat
aaagttccagatgagtatttctcttttaattatgaaggcattgtcagaaacctcacatgc
atagaaccaaatcagccgttcaaagcttacatgaagcagtttctacccaagcgtttccat
tatgccaataatgaccggattgaaccgctgcacttttatttaaattctcagtggcaacta
gctaggaaaccgcttgagattaaaagttgcacgggtggattccatggctcagataatcgc
ttcccaaatatgcaggctatctttattggttttggaccgggattcaaatttcaaactcaa
gttgatccatttgaaaacattgaagtatataacttaatgtgtgacttgcttgatttgaag
ccagccccaaacaacggaacccatggacgtctaaataatctcttaaggaatcctgtttac
atccctcaccatcccaaagaaacaagccatccttctgaatgctcttttgtgggacaaaga
acctttccagtgagccttggctgctcctgcaggacagcaggtttgccagtaagagatttt
catcagcgtttaaatcttactgaaacagaagttaagaagacagagacactcactttgccc
tatggacggcccagggttctgcaaaagaaacataattactgcgtcctttaccataaccgc
tatgtaaatgggtacagcaaggactataagatgtctctgtggagtgcgtacactgttaac
aaaaatgacagttggatttctactacagaagatatttccagctgtttacgcaaggatgtt
cgtgttccttctaatcataaccagacgtgttcattttacaacaatcatcctcgactaact
tatggatttctttctcctccaaactttatgaaatctcattatgatgccttgctcaccagc
aacattgtgccaatgtatcctgcatttaaagtgttatggaactactttcatcagtccctg
ctgcctgagtatgctgcagacagaaatggagtcaatgtagtaagtggtcctgtgtttgat
tacgactctgatgggatctatgataacccagaaaaagtgaaaagacaccctggtaattca
gaagttcccattcctactcatttcttcattgtgctgactacttgtaaaaatacttctgaa
actcctttgaagtgtgaaggatcccttgatgccttgtctttcattgtacctcacagagaa
gacaatagtgaaagctgtgcagatgggaggtctgagtcactgtgggttgaagagagaatg
aagtttcacatagctcgggtcagagatatagaattacttacaggactcagcttctatcaa
gacagaaaacagccagtatctgacattttagagttaaaaacgtatctaccaacttttgaa
actgtctga

DBGET integrated database retrieval system