KEGG   Coturnix japonica (Japanese quail): 107312541
Entry
107312541         CDS       T04297                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04080  Neuroactive ligand-receptor interaction
cjo04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107312541 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107312541 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107312541
NCBI-ProteinID: XP_015715548
Position
4
AA seq 151 aa
MPPPGHPGGLQRGGGGASCGPPRPPFGAGGHMTGRARGRAGLSPPTNAAIPERGHRLLRV
RVPACPCPRAGRSMAARRWLLALLLLFCLALSAASAGPLGAGLDGMDPEDGLIRTLVRPR
GARRGNVRRPGGWRRLRRPRPRLSHKGPMPF
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccaccccctgggcaccccggggggctgcagcgcggagggggcggagcgagctgcgga
cccccccgcccccccttcggtgccggcggccacatgaccgggcgggcgcggggccgggcc
gggctctcaccgcctacaaatgcggcgatcccggagcggggccaccgcctcctgcgtgtc
cgtgtccccgcgtgtccgtgtccccgcgccgggcggagcatggcggcgcgccgctggctg
ctggcgctgctgctgctcttctgcctcgcgctgagcgccgcgtccgcggggcctctggga
gcggggctggacgggatggatcccgaggacggcctcatccgaacgctggtgcggccacgg
ggtgcgcggcgtgggaacgtgcggcggccaggagggtggaggaggctgcgccgtccccgg
ccacggctgtcccataagggccccatgcccttctga

DBGET integrated database retrieval system