KEGG   Coturnix japonica (Japanese quail): 107312764Help
Entry
107312764         CDS       T04297                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107312764 (CACNA1I)
   04020 Calcium signaling pathway
    107312764 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjo04040]
    107312764 (CACNA1I)
Ion channels [BR:cjo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107312764 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DUF3043
Motif
Other DBs
NCBI-GeneID: 107312764
NCBI-ProteinID: XP_015715932
Position
1
AA seq 2192 aa AA seqDB search
MAECIPQPPPTWSAGPQPHNTSAACPLEPVNMEVSEQQMPLEQPLSSPELGEDEEVTSPP
DPDVPYPDLAPVVFFCLKQTTSPRSWCIKMVCNPWFECVSMMVILLNCVTLGMYQPCEDM
DCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEY
SLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGI
VGVQLWAGLLRNRCFMEENFTIQGDIVLPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPP
LKERGHECCLDKDDYYYYNSVRQEFNVSGMCVNWNQYYNVCRTGNANPHKGAINFDNIGY
AWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETK
QRENQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHIMRKAKRRTLGLYNSIQSRRQ
GHIEPSEAKQGISRQKQRHYRMCQQHNPLDRPPQGLVQPIAVTATSDLTNCPQCHRGEHD
TSRRLSVLDSADSDQEDGGDSEAEGEGCRGDQSASALEKEEEEVEEGGRMKLCSDMWREV
RVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEISNVVFTSMFALEMIL
KLAAFGLFDYLRNPYNIFDSIIVIISIWEIIGQSDGGLSVLRTFRLLRVLKLVRFMPALR
RQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTDTGDTVPDRKNFDSLLW
AIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEG
DANRSYSEEDQSSSNMEELDQFQEIQEGSDPKLFAISVTPNGHLDPSLPSSNAPVAAGRV
SNSSRNSLQPDQICVAVGSRKSSVMSLGRMTYDQRSLSSSRSSHYGAWGRSGAWGSRRSS
WNSLARGHSLKHKPPSAEHESLLSRERHRAGDRELDGAERVFHHRRTLSLDNKGSCDLLE
LASIPSGHRGTCRPGTTSGGSDHQDCNGKMPSIAKEIFPRMNNHKERGEDDEEIDYSLCF
RIRKMMEVYKPDWCELREDWSIYLFSPQNRFRLLCQTIIAHKLFDYVVLAFIFLNCITIA
LERPQIEHRSMERIFLTVSNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNVLDGFLV
FVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGN
IVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSDCVAANYKWVHHKYNFDNLGQ
ALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVG
VVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPIRLLIHSVCTSHY
LDIFITFIICLNVVTMSLEHYNQPVSLETALKYCNYLFTTVFVLEAVLKLVAFGLRRFFK
DRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRAL
LDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAF
LTLFRVSTGDNWNGIMKDTLRDCSHDDRSCLSNLQFISPLYFVTFVLTAQFVLVNVVVAV
LMKHLEESNKEAKEDAEMDAEIELEFAHGLCSRKSASSKSRQGKGAGTGGGGGRTEPEGR
LCTRCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCNHDKQEV
QLAEMEALSLNSDKSSSILLGDESDNRSTSQLSPKETKDGQDSPDSTEAGDLGECLLPIS
STDGSTNPDSYLCEIEKTPFNSVQSWLKHEGTKAPSSPFSPGTSCPLLPVPAEFFHPAIS
AAQTGPEKVSCTHNLPKISLQGSWASLRSPSVNCSLLRQAHESDTSLDSRSSSSVGSLQT
TLEDSLNLSDSPQCALDLPVALCPMPATSDPRPLAAPLSPTSCRRSLRGRGLFTLRSIRQ
HQRSHSSGGSTSPGCTHHDSMDPSDEEGAGSSLRGGGNNSEPSETLSSLSLTSLFSPPPP
GLTLGKKCSSTSSLHASPSPCRPTAHHTKPFYTVDPKGFLSMPSWVTDFCKDTPPPVQGA
EPDGPSRLGTRECSSPLPSELELGDGVSKKNR
NT seq 6579 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtgcatcccccagcctcctccaacctggtctgctggcccacagccccacaac
acctccgctgcctgcccactggagcctgtgaacatggaggtctcagaacagcaaatgcca
ctggagcagcccttatcctccccagagctgggtgaagatgaggaagtcacatctccaccg
gaccctgatgttccctatcctgacttggccccagttgtcttcttttgcttgaagcaaact
accagcccacggagctggtgcatcaaaatggtgtgcaacccctggtttgagtgtgtcagc
atgatggtgattttactaaactgcgttaccctggggatgtaccagccgtgtgaggatatg
gactgcctttccgacaggtgtaaaatcttgcaggtatttgatgattttatcttcatcttc
tttgcaatggaaatggtgttaaagatggtggccctggggatctttgggaagaagtgttac
cttggagacacgtggaaccgcctggacttcttcatcgtcatggcggggatggtggagtac
tctctggatctccaaaatattaacttgtctgcaattcgtactgtccgcgtcctgagaccc
ctgaaagctatcaaccgtgtgcctagcatgcgcatccttgtgaatttgctcctggacact
ctgcccatgctggggaacgtcctcctgctctgcttctttgtcttcttcatcttcggcatc
gtcggggtgcagctgtgggcagggctgctccgcaaccgctgcttcatggaggagaacttc
acaatacaaggtgacattgtcctgcccccatattatcagcctgaggaagatgatgagatg
ccctttatctgctcactgtcaggagacaatggaatcatgggctgtcatgagatcccaccc
ctgaaggaacggggccatgagtgttgtttggacaaagatgattattattactacaactct
gtccgtcaagagttcaacgtcagtggcatgtgtgtcaactggaaccagtactataacgtg
tgccgtacaggcaatgccaatccacacaagggtgccatcaactttgacaatattgggtat
gcctggattgtgatatttcaggtgatcacactggaagggtgggtggagatcatgtactat
gtgatggatgctcattcattctacaattttatctactttatcttgctgataattgtgggc
tccttcttcatgatcaatctgtgcctggtggtcatcgccacacagttctcagaaacaaag
cagcgggagaaccagctgatgcaggagcagcgggcccggtacctctcctccagcactgtt
gccagctacatggagcctggagactgctatgaggagatcttccaatatgtttgccacatc
atgcgcaaagccaaacgccgcacccttgggctgtacaacagcatacagagccggcgccag
ggccacatagagccgagtgaagccaagcaaggcatcagcaggcaaaaacagaggcactac
agaatgtgccaacagcacaaccctcttgaccgccctcctcaaggcctggtccagcccatt
gctgtgacagcaacctctgatctcaccaactgcccccaatgccataggggggaacatgac
acatcccgaaggctttctgtcctggacagtgctgactcagaccaggaagatggaggagac
agtgaagcagagggagaaggctgcagaggtgaccagagtgcatcagctctggagaaggag
gaagaagaggtggaggaaggtgggaggatgaagctgtgtagtgacatgtggcgggaagtt
agagtcaagcttcgagggattgtggacagcaagtacttcaaccgtgggatcatgatcgcg
atccttgtgaacactatcagcatgggcatcgagcaccatgagcagccagaggaactgacc
aacatcttggagatcagcaatgttgtctttacaagcatgtttgccctggagatgattctg
aaacttgctgcttttggcctctttgattacctccgcaacccctacaacatctttgacagt
atcatcgtcatcatcagcatctgggagatcatcggtcagtcggatgggggcctctcagtg
ctgaggacattccggctgctccgggtgctgaagttggtacgtttcatgcctgcactgcgc
cgccagctggtggtcctgatgaagactatggacaacgttgccaccttctgcatgttgctc
atgctcttcatcttcattttcagtatcttgggaatgcacatctttggatgcaagttcagt
ctgaagactgatacaggagacacagttccagatagaaagaattttgactccctgctgtgg
gccattgtcactgtcttccagatcttaacccaggaagactggaatgttgtgctctataat
ggcatggcctccacctcaccatgggcatccctttactttgtggctcttatgacatttggc
aattacgtactcttcaatctgctggtggccatcctcgtggaggggttccaggctgagggt
gacgccaaccgatcatactcagaggaagatcagagttcatcaaacatggaggagttagat
cagttccaagagatccaggaaggctcagatcccaagctttttgcaatttctgtgacacca
aatggccacttggacccatcattgccctcttccaatgccccagttgctgctggcagagtc
tccaactcctcacgcaactccctgcagcctgaccagatctgtgttgctgttggctcccgg
aaaagtagtgtgatgtccctggggagaatgacctatgatcagcgatccttgtccagctct
cgcagttcccactatggtgcctggggccgcagcggggcctgggggagccgtcgctccagc
tggaacagcctggcccgaggacacagcctgaagcacaaacctccctctgctgagcacgag
tccctcctgtctcgggagaggcacagggcaggagatagggagctggatggagcagagaga
gtgtttcaccaccgccggacgctctctctggacaacaaaggttcctgcgacttgctagag
ttggcctccatcccatctggccacagagggacctgtaggccagggacaacatcaggaggc
agtgatcatcaagactgcaatggcaaaatgcccagtattgcaaaagagatcttcccaagg
atgaacaaccacaaggaacggggagaggatgatgaagagatagactatagcctgtgtttt
cgcatccggaagatgatggaagtctataagccagactggtgtgagttacgagaagactgg
tctatatatcttttctctccacaaaacaggtttcgcctcctctgccaaaccatcattgct
cacaaactctttgactatgttgtgttggccttcatcttcctgaactgcatcaccattgca
ctggagagaccacagatagaacacagaagcatggagagaatctttctcactgtgtccaac
tacattttcacagcaattttcgtggctgagatgacattgaaggtggtctctctaggcctc
tattttggggatcaggcttatctccgcagcagctggaatgtcctggatggcttcttggtc
ttcgtgtctctcattgacattgtggtctcagtggcttctgctggcggtgccaaaatccta
ggggtgctgcgggtcctccggctgctgcgcacgttacggccactccgagtcatcagtcga
gctcctggccttaagctggtggtggagacactcatttcttccctcaagccaataggaaac
attgtcctcatctgctgcgctttcttcatcatttttggcatcttaggtgtacagctcttc
aagggcaagttctaccactgcctaggggttgacatcaggaacatcaccaaccggtctgac
tgcgtggctgccaactacaagtgggtgcaccacaaatacaactttgacaacctgggacag
gccctgatgtctctctttgttctggcttccaaggatggctgggtcaatattatgtataat
ggactagatgctgtggctgttgaccagcagccggtgaccaacaacaacccctggatgctc
ctctacttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggg
gtcgtggtggagaacttccacaagtgccggcagcaccaggaggcagaggaggcccgtcga
cgagaggagaagcgcttgcggcgcctggagaagaagcgaaggaaggcgcaacgtttgccg
tactatgctacctactgccccatacgcctccttatccattcggtctgcacgagccactat
ctggacatcttcatcactttcatcatctgcctcaacgtggtcaccatgtccttggaacac
tacaaccaacctgtgtccctggagaccgctctcaaatactgtaactacctgttcaccact
gtgtttgtgttggaggcagttctcaagctggtggcctttggtctgcgtcgattcttcaag
gacaggtggaaccagctagatctggccattgtgctgctgtctgtcatgggcattacactg
gaagagattgaaatcaatgcggctctcccaattaaccccactatcatcaggatcatgaga
gtgctgcgcatcgcccgcgtcctgaagctgttgaagatggccacaggaatgcgagcactg
ctggatacagtcgttcaagccttaccacaggtggggaaccttggactgcttttcatgctc
ctctttttcatctacgctgctctaggagtggagctctttggaaaactggtatgcaacgat
gagaacccctgcgagggcatgagccgtcatgctacctttgagaactttgggatggccttc
ctcaccctcttccgggtgtccacaggggacaactggaatggaatcatgaaggatacctta
cgcgactgcagccatgatgaccggagctgcctcagcaacctgcagttcatctccccactg
tactttgtcacctttgtactcacagcccagtttgtcctggtcaacgtggtggtcgctgtg
ctcatgaagcacctggaggagagcaacaaggaggccaaggaggatgcagagatggatgct
gagattgagctggaatttgcacatgggctgtgctcccgcaagtcagcctcctcaaaatca
aggcagggaaaaggagcaggaacaggaggcggtggtgggagaacagagcctgaaggacgt
ctgtgcacgagatgctactctccagcacaggagaacttatggctggacagtgtctcttta
attattaaggactccttcgacggggagttaatgatcatcgataacctatcgggctccgtc
ttccatcattactcctcgccggccatgtgcgagaagtgtaaccatgacaagcaagaggtc
cagctggctgaaatggaagcattatctctcaattcagacaagtcctcttccatccttcta
ggagatgagtcagataatcgcagcacttctcagctgagtcctaaggagaccaaggacggc
caggacagccctgactccactgaggcaggagatctgggggaatgcttgcttccaatatcc
agcacagatggctccacaaacccagacagttacctgtgtgaaatagagaaaactcctttc
aactcagtccagtcttggctaaagcatgaaggtaccaaagccccttccagccccttttct
ccaggtacatcttgccctctgttacctgtaccagcagaatttttccacccagccatctct
gctgcccagacagggcctgagaaggtctcgtgcacacataaccttcctaagatctctctg
caaggctcatgggcatcactgagatctccgagtgtgaactgttcacttcttcgccaggct
catgagagcgacacgtcgctggacagtcggagcagcagctcggtgggcagcctgcagacc
acactggaggacagcctcaacctcagtgattctccccagtgtgctctggacctcccagtg
gccctgtgccccatgccagccaccagtgacccaagacccctggcagcccccctgtccccc
acctcctgtcgccgcagcctgcggggccgggggctgttcaccctgcgcagcatccgtcag
caccagcgcagccacagcagtggtgggagcaccagccctggttgcacccaccatgactcc
atggacccttcagatgaggagggagcaggaagcagtttgcgggggggaggcaacaacagt
gagccctcggagaccctcagcagcctctcgctgacctcccttttctcacccccaccacca
gggctgacgctggggaagaagtgcagcagcaccagcagcctccacgccagcccttcaccc
tgccgtcccactgcccaccacaccaagcccttctacaccgttgaccccaagggcttccta
tccatgccctcctgggtgacggacttctgcaaggacacccctccaccagtgcaaggagca
gagcctgatggccccagtagactgggaacaagggaatgcagctccccgctgccatccgag
ctggagcttggcgatggggtcagcaagaagaacagatga

DBGET integrated database retrieval system