KEGG   Coturnix japonica (Japanese quail): 107313354
Entry
107313354         CDS       T04297                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00230  Purine metabolism
cjo00240  Pyrimidine metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107313354 (DCK)
   00240 Pyrimidine metabolism
    107313354 (DCK)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107313354 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 DUF5066 AAA_17 Dynamin_N
Other DBs
NCBI-GeneID: 107313354
NCBI-ProteinID: XP_015716992
Position
4
AA seq 257 aa
MATPPKRGRLDGRVKKIAVEGNIAAGKSTFVNILKQADEGWEVVPEPVARWCNVQQNSEE
DCEELTTSQKSGGNVLQMMYEKPDRWSFTFQMYACLSRIRAQLKSIDGKLREAENPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHKTLRTDFEYLQEIPILTLDVNEDFKGKK
DRYDHMTEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcgactcctccaaagcgcgggcggctggacggcagggtgaagaagatcgctgtggag
ggcaacatcgctgctgggaaatcgacatttgtgaatattctcaaacaagccgatgaggga
tgggaagttgttcctgagcctgtagctagatggtgcaacgtccagcagaactctgaggag
gattgtgaggaactgactacatcacagaagagtggtggaaatgtgcttcagatgatgtat
gagaaaccggacaggtggtctttcactttccagatgtatgcatgcctcagcaggattcgg
gctcagctcaaatccattgatggcaaactcagagaggcagagaatcctgtggtgttcttt
gagcgatctgtctacagtgacagatatatctttgcagctaatttatatgaatctgactgt
atgaatgaaactgagtggactatttaccaagactggcatgactggatgaataagcagttt
ggtcaaagcttagcactggatgggattatttatctcagagccactcctgagaaatgctta
aataggatttacttgcgtggaagagatgaagagcaagaaattcctattgaatatctggag
aagcttcactacaaacatgaaagctggcttcagcataagacactgcgaacggattttgaa
tatctacaagaaatacctattttaacgttagatgttaatgaagacttcaaaggcaaaaag
gacagatacgatcacatgactgaaaaggtgaaggaatttttgagcacattataa

DBGET integrated database retrieval system