KEGG   Coturnix japonica (Japanese quail): 107314846Help
Entry
107314846         CDS       T04297                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00564  Glycerophospholipid metabolism
cjo00565  Ether lipid metabolism
cjo00590  Arachidonic acid metabolism
cjo00591  Linoleic acid metabolism
cjo00592  alpha-Linolenic acid metabolism
cjo01100  Metabolic pathways
cjo04010  MAPK signaling pathway
cjo04217  Necroptosis
cjo04270  Vascular smooth muscle contraction
cjo04370  VEGF signaling pathway
cjo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107314846
   00565 Ether lipid metabolism
    107314846
   00590 Arachidonic acid metabolism
    107314846
   00591 Linoleic acid metabolism
    107314846
   00592 alpha-Linolenic acid metabolism
    107314846
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107314846
   04370 VEGF signaling pathway
    107314846
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107314846
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107314846
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107314846
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107314846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 107314846
NCBI-ProteinID: XP_015720063
Position
5
AA seq 785 aa AA seqDB search
MRNLQRVDALSQADCYVSLWLPTASIEKCRTKTVRNSNDPVWNETFYFRIQSKVKNVLEL
TVYDEDFATPDDHLLCTLFDIAKLPIEKTVLLYFKPSSTAQEELEVEFKLETLSSPYESI
ATNGVLVCRELCCLEVEVNEKQQKKSKKELSLTVKGSFEGTQDITLGPDGVVSPSGPTKF
HYIKYAEPTLDVMLPKKRRYHPWSCRFRTETGSPVLMLNSLPMGKKTTIAEEKRFDLNVK
AERCNCSCQQDLDMRFGFDLCSDERAFLGKRKKYVASALKNVFHLKEDLQDHEVPVVAII
TTGGGLKSMTGLYGSLMGLKKLNLLDCVTYISGLSGTTWTMANLYRDAYWSQKDLDSHIS
EAQKHATKCKMGCFSMDRMKYYNKQLCQRKEEGYRTSFIDLWGLMIEYILNDGKDPHKLS
DQREALCDGQNPLPIYVSVCVRDNYSTQDFKEWVEFTPYEVGLLKYGAFIPAENFGSKFF
MGRMLKKLPESRICYLQGMWSSIFSVNLLQIWGLSHSSEDFWHRWTQDKIDEVDEDPVLP
TRPHELRTRVYTPPGNLSNALRGALTDRFSVAQHHNFLRGYQLHNDYFENEHFCQWKDTV
LDSRPNELMQNPDHLGMIDAGFFINTSSPPLLRRQREVDVIIYLSYTTGSHTSSLDKACK
YYSEQKIPFPKISLSDEDKKNLKECYVFQDSDSPGCPIVIFLPLVNDTFQEYKAPGVKRC
CSEMEEGKLDLTSRCSPYCMFSVRYTDENYRRLLNLSEYNILNNSDMIMQSLQTAMQRRR
QNMCC
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccagcgtgtggatgctttaagccaggctgattgctatgtttcactgtgg
ctgcctacagcatcaattgaaaagtgccgtaccaaaacagtaaggaactccaatgaccca
gtgtggaatgaaaccttctacttcaggattcagagtaaagtcaagaatgtgctggagctg
acagtgtatgatgaggattttgctacaccagatgaccacctcctctgtacactctttgat
attgctaaacttcctattgagaaaacagtgctcctgtatttcaagcccagctcaacggcc
caggaggaactggaagttgaattcaaactggagaccttgtccagtccttatgaaagcatt
gctacaaatggagtcttagtgtgtcgtgaactttgttgcttggaagtggaagtgaatgag
aagcagcagaaaaagtcaaagaaggagctttcccttactgtgaaaggatccttcgaaggg
acacaggatatcacactgggccctgatggagtggtcagcccatcaggtcccaccaagttc
cactatatcaagtatgctgagccaacactggatgtcatgttgccaaagaagaggcgctac
cacccttggtcctgcaggttcagaacagaaacaggatccccagtgctgatgctgaattca
ctgcctatgggaaagaaaacgacaattgcagaggagaaaagatttgatttgaatgtgaaa
gcagaaagatgtaactgttcgtgccagcaagatctggacatgcgctttgggtttgactta
tgttcagatgagagggctttcctgggcaaaaggaagaaatatgtagcaagtgccctgaaa
aatgtttttcacctaaaagaggatctacaggatcatgaagtccctgttgtggctatcatc
acgacaggtggtggattaaagtcaatgacaggactatatggcagtctcatgggactcaag
aaattaaatcttctggactgtgtaacctacatcagtgggctgtctggtaccacatggacc
atggccaacctatacagggatgcctactggtcacagaaggaccttgactcacatattagt
gaagcccagaaacacgcaaccaaatgcaagatgggctgcttctctatggatcgcatgaag
tattacaataagcagctctgtcagcggaaagaagagggatacaggacatcatttattgat
ctctgggggcttatgattgaatacatactaaacgatgggaaagacccccacaaactttca
gatcaacgagaagcgctgtgtgatggccagaacccactgcccatctatgtgtcagtctgt
gttcgggacaactacagcactcaggatttcaaagagtgggtagagttcaccccctacgag
gtggggctgctgaagtatggcgcgttcatccctgcagaaaattttggaagcaagttcttc
atgggacgcatgttaaaaaagctgcctgaatctcggatctgctacctgcaaggtatgtgg
agcagtattttttctgtgaacctgttacaaatctggggactgtctcacagttcagaagat
ttctggcacagatggactcaagacaaaattgatgaagttgatgaagacccagtgttgcct
acaaggccccatgagctaagaactcgtgtgtatacaccccctggcaatctgtccaatgct
cttcggggtgctttgactgaccgcttctcagttgcccagcatcacaatttcctgaggggt
tatcagctacataatgactacttcgaaaatgagcacttctgtcaatggaaagacaccgtg
ttagactcacgtcccaatgagctgatgcaaaatcctgatcacctgggcatgatagatgct
ggatttttcatcaataccagcagtccaccacttctaaggcgacagagggaagtagatgtc
atcatatatttaagttatactactggatctcatacatcgtctctagataaggcatgcaaa
tattactcggagcagaaaatcccattcccaaaaatttctttgagtgatgaagataagaaa
aacctgaaggaatgctacgtcttccaagattcagattcgccaggatgccctatcgtgatt
tttcttccacttgtgaatgataccttccaggaatacaaagcacccggtgtcaagcgctgt
tgctcagagatggaggaaggaaaactcgacctgaccagtcggtgttccccttactgcatg
ttctcggtcaggtatactgatgagaattaccgccggctgctgaacctcagtgaatacaat
atcctgaataactcagatatgattatgcagtccttgcaaacagcaatgcaaaggagaaga
caaaacatgtgctgttaa

DBGET integrated database retrieval system