KEGG   Coturnix japonica (Japanese quail): 107315287
Entry
107315287         CDS       T04297                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjo01009]
    107315287 (AKAP5)
Protein phosphatases and associated proteins [BR:cjo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     107315287 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 107315287
NCBI-ProteinID: XP_015720945
Position
5
AA seq 758 aa
MQWLHWSSSAHCHLLKSNCCCFEDNWGKKPFEHLCSFYALIRKSVHRRRRGTNMAKAAKE
IHMENPSELETPSAGTPCPPLEEQAEKPSMLCFKKRKKRTTMKETCGGASAASEEKNQCI
STDPGEAKASELRPSRGAWAALKSLTKPRRGQKSSSRKKVSSDSQVQLEMDAEESCAQGL
PRKKAGSGVKMPCVRFLRGKKKPSPSEVVEESEDSAQANEVMGILNKAIEELEDMAPEEP
CDKAESLSPLPAEDMAPVEPCNKAETLSLLPAQNSAPTEPCDKAESLSPLPAEDMAPAEP
CDKAESITPLPAEDMAPIGPCNKAETLTPLPAQNSAPAEPCDKAESLSPLPAEVMAPVES
CDKTEPLSPLPAEDQAPVEPCDKAESLSLHPAQNLAPAEPCDKTEPLGPLPAEDQAPAEP
CGSAEALSSLPAEDMTPAEPCDKAKSLGLLPAQNSAPAEPCDKAESLSPLPAEDQAPAEP
CGSAEALSPLLAEDQDMSAEGADADGRSEPSGEPRPDVAEHTECITRSEITSLEPVNEPV
QEKPTEGSPHQSAAQVEEREVTPEAPVSTDQPNGTPEITKLQEIAAICKELPERDESERN
TDLPEECRSEETTTDFSPSVSKDDTTSVQSSSSRHEKPEVNMGTAVGIVITITEAMDSDD
ADSDQAYEPSPVLHHNKQKGNKKSSGSFDFGQKEGPGAGSGAVVEEKGLGDQGHRTSDQY
ELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgcaatggcttcattggagcagctctgcacattgccacttgttaaagagcaactgctgt
tgttttgaggacaactgggggaaaaagccatttgagcatctctgcagcttctatgcatta
ataagaaagtcagtacacagacggaggagaggtacaaatatggcaaaggcagctaaggaa
atacacatggagaacccaagtgagctggagactcctagtgcaggaacaccgtgcccccca
ttggaagaacaggcagaaaaaccctccatgctctgctttaagaagcggaagaagaggaca
acaatgaaagaaacatgtgggggagcttctgcagcctcagaggagaaaaatcaatgtatc
agcacagacccaggggaggcaaaagcttctgaattgcgaccctccagaggagcctgggca
gctctcaaaagtctcacaaagcctcggagagggcagaaatcctcttcgcggaagaaggtg
tcctctgattcccaggtgcagctggagatggatgcggaggagagctgtgcacaaggtctt
ccaaggaaaaaggccggctcaggggtgaagatgccctgtgtgcgcttcttgagaggcaag
aaaaagcccagcccctcagaggtggtggaggagtcagaggacagtgcccaagcaaatgaa
gtgatgggcattttgaataaagccattgaagagctggaggacatggcccctgaagagccc
tgtgacaaggctgagtccctcagcccgctccctgcagaggacatggcccctgtagagccc
tgcaacaaggctgagaccctcagtctgctccctgcacaaaactcggcccctacagagccc
tgtgacaaggccgagtccctcagcccactccctgcagaggacatggcaccagcagagccc
tgtgacaaggctgagtccatcactcctctccctgcagaggacatggcccctatagggccc
tgcaacaaggctgagaccctcactcctctccctgcgcaaaactcggcccctgcagagccc
tgtgacaaggctgagtccctcagtccactccccgcagaggtcatggctcctgtagagtcc
tgtgacaagacggagcccctcagtccgctccctgcagaggaccaggcccctgtagagccc
tgtgacaaggctgagtccctcagtctgcaccctgcacaaaacttggcccctgcagaaccc
tgtgacaagactgagcccctcggaccactccctgcagaggaccaggccccagcagagcca
tgtggcagcgctgaagccctaagctcgctccctgcagaggacatgactcctgcagagccc
tgtgacaaggccaagtcccttggtctgctccctgcacaaaactcagccccagcagagccc
tgtgacaaggctgagtccctcagcccgctccctgcagaggaccaggccccagcagagcca
tgtggcagcgctgaagccctcagtccactcctcgcagaggaccaggacatgtcagcggaa
ggtgctgatgctgatgggaggagtgaaccctcaggagagcccaggcctgatgtggctgaa
cacacagagtgcatcactcggtcagaaataaccagtttggagcctgtcaatgagccagtg
caggaaaagccgactgaggggagtccacaccaatctgcagcacaagtggaagagagggaa
gtcactcctgaggcaccagtttccacagatcaacccaacggcacccctgaaatcaccaag
cttcaggaaatagccgccatctgcaaagagcttcctgagagggatgagtcggagaggaac
actgatctccctgaggagtgcagatctgaggagaccacaacggatttcagcccatcagtg
tctaaggatgatacaacgagtgtgcagagcagctccagccgtcacgagaaaccagaagtc
aacatgggcactgccgttggcatcgtcatcaccatcactgaagctatggactctgatgat
gctgattctgatcaggcctatgagccatccccggttttacaccacaataagcaaaaaggg
aataaaaagtccagtgggagctttgattttggtcaaaaagaaggccctggggctggcagt
ggtgctgtggttgaagagaaaggtctgggcgaccagggacacaggacttcggatcagtat
gaattgctcctcatagaaacagcgtcttctcttgtgaaggcggccatccagtcgtccata
gagcagctggtcaacgagatggctctggaacagaataaacacaacagttttctgtga

DBGET integrated database retrieval system