KEGG   Coturnix japonica (Japanese quail): 107315528Help
Entry
107315528         CDS       T04297                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjo01002]
    107315528 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjo04147]
    107315528 (ABHD12B)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107315528 (ABHD12B)
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107315528 (ABHD12B)
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107315528 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Cutinase Lipase_3 Peptidase_S15 Say1_Mug180 PGAP1 LIDHydrolase VirJ
Motif
Other DBs
NCBI-GeneID: 107315528
NCBI-ProteinID: XP_015721461
Position
5
AA seq 358 aa AA seqDB search
MRRRGGAETAGRGDGDGGGTAGNSKERSRGGWLGWCPRLRTILLQMLLIYISVPFLVRLF
PVILTKFVFLNFMAFPFFVDLRQPALLLNNTISLYLPTEPGVTVGIWHMVPGSSGTEAQG
REQRWFEEALADDHPIIIYLHGNGGTRAARHRIQFMKLMGAAGFHILALDYRGYGDSTGH
PSESGFTTDVLALYDWAKARSGNSSIIFWGHSLGTGIATNAARKLQEERGVQVDAVVLES
PYTNIRDAAANIPITKIYRQFPGFEYLILDSMALGNMFFRNDENVKVLACPLLILHAEDD
TVLPPQLGRQLFETARSAYKDKSKVKLITFPEKLGLGHDYISSNPELPTLVKDFLNMK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcgcggcggcgcggaaactgcgggacgtggggacggcgatggcggcgggacg
gcggggaacagcaaggaacggagccgagggggctggctgggctggtgcccccgactgcgc
accatcctcctgcagatgctcctcatctacatctctgtgcccttcctggtccgccttttc
cccgtcatcctcaccaagtttgtcttcctaaacttcatggcgttccctttctttgtggac
ctgcggcagccagcactgctgctgaacaacaccatcagcctctacctgcccaccgagccg
ggcgtcaccgttggcatctggcacatggtgccgggcagcagtgggactgaggcgcaaggt
cgggagcagcgctggttcgaggaggctctggccgacgatcaccccatcatcatctacctg
cacggtaacgggggcaccagggctgcacgccaccggatccagttcatgaagctgatgggg
gctgccggcttccacatcctggctctagactacagaggctatggggactccactgggcac
ccctcggagagcggcttcaccacggacgtcttggcgctgtacgactgggccaaagcacgc
agtgggaacagctccatcatcttctggggacactccttggggactgggattgcaaccaac
gcagccagaaagctgcaggaggagagaggggtccaggtggatgccgttgtgctggagtcc
ccctacaccaacatccgcgacgcagccgccaacatccccatcactaagatttatcggcag
ttcccaggatttgagtacctcatcttggactccatggctctgggcaacatgttcttccgc
aacgatgagaatgtgaaggtgctggcctgcccgctgctcatcctgcacgcagaggatgac
accgtgctgcccccacagctgggacgccagctcttcgagaccgcacgcagcgcctacaag
gacaagagcaaggtgaagctcatcaccttccctgagaagctggggctgggccacgactac
atctcatccaacccagagctgcccaccctggtgaaagatttcttgaacatgaagtga

DBGET integrated database retrieval system