KEGG   Coturnix japonica (Japanese quail): 107316443Help
Entry
107316443         CDS       T04297                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00562  Inositol phosphate metabolism
cjo01100  Metabolic pathways
cjo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107316443 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107316443 (PIK3C2G)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     107316443 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX C2 PI3K_C2 DUF4135 PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 107316443
NCBI-ProteinID: XP_015723380
Position
1
AA seq 1479 aa AA seqDB search
MAYFGKVPFSGDEFYEGHSGDQASYLAYHSGSYGKVYLGFDQIVDEVNNEFFFYGSSHLH
HPEEEHFFTSDIFSLNVPEQQLCSQPSVACCELHSENFVPHWQQGSMSPKIGFKSSLLSD
DGNFSLVDSYPYNQEREIYRWNSITPVTNVFNSNVERSYTYWNYQIGFDNVDAQCPVSLN
NYPFGQRRDENGKGETCLTSTSRRFSIGPTWPNSPGHDKEITSWSIQLIKADQGSNENVI
SFCNTVEKIRNAYPACDLKTNSGKIWSVVTKFPDNILGKTRFRISIWTDSSPSPLLLTQH
AGCITHDLIVEILRCTNQYPVHEECFLSVCGSDEVLQNNHSLGSHESLRKATTDIHLHLH
TTTNLKQSLARMHEDDQNKFSVNELLEYTCAWRLTRQNLVAALRKYRGQVEHLLQNEPHN
VDYVIEVTKEICSVLCFVETREITNAVKKLRAVPLVKTQDSLQRVEAQALMEAAVTELSM
AISHLIHVYSSSIDTDFQVANAPRSPSHADISLDSQLSFTVYAAHNIPEAWVNRYKVFSF
SCLLTYAGKTICQVKICKNIPIRKSFFFLTDWNEKINFPLRIKALPRETMLTIKLLGLNS
ASKTTEVLAWTCCPLYQKEQLIHGTVLLSMKLYSMLPAAMITPGICSTDAPTSVMLQFEF
PETDLKFINPEPEERRDDLEEPTEECLKHIARLSQAHSLLLLSEQQKRILWFYRYYCNNQ
NCSLPLVLGSAPSWDRTTMSEMYSVMRKWRFSNPVEALGLLTFSFPDKDIRRTAVQQIEN
LSNDELLEYLPQLVQVLKFEWSLEGPLVKLLLNRSLQSIQVAHQLYWLLKNAQNEVHFKT
WYRKLLAALQFTAGKTLSNEFSKEEKLNRILEDIAEKVKAASDTKRKEVLKMELNRLQQF
FQEVKVCRLPLNPALVVQGIEADSCSYFTSNAFPLKISFINATAPSGNINIIFKIGDDLR
QDMLVLQIIRVMDNIWLQEGLDMQIIIYRCLSTGKGQGLVQMVPDATTLAKIHRESGLIG
PLKENTIKKWFRHHHRLESSYQEAIRNFFHSCAGWCVVTFILGVCDRHNDNIMLTNAGHM
FHIDFGRFLGHAQTFGSIRRDRAPFIFTSEMEYFITEGGKNPQRFQEFVELCCRAYNIVR
KHSQLLLNLLEMMLHAGLPELNSIQDLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPV
KLNNLIHTLAHMSLTSSTKLPSQETVPQEWMMLNAEKSIARATILGFNKKSDYLYLVQVV
QTCNVVTFVEKSFDQFSELHSNLQKQFPSHTLPEFPHSWHIPFTDLEHKRVKDLNLYLKQ
LLNGSRKLANNELVLRFFLNWSKHTLTETASSVTSGPQSTDGTPGVQLVISYEGTHLTVM
LKHMRNIRLPDGSAPSVHAEFYLLPDPDEVNRRKTRTVPKTTNPTFNEIVVYNKVMQLEG
RILKLVVKSKGTFVGAVNIQLSRVHLNEEKWYPLGNSIF
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggcatactttggaaaggtgcctttctcaggtgatgaattttatgaaggacattctgga
gaccaagcatcttacctggcataccattctggttcttatggaaaggtctatctgggcttt
gatcaaatagttgatgaagtcaacaatgaatttttcttttacggttcttcacacttacat
catcctgaagaagaacattttttcacatcagatatctttagtctgaatgtgccagaacag
cagctttgcagtcagccttcagttgcttgttgtgaacttcactctgaaaattttgtacct
cactggcaacaaggctcaatgtcaccaaagattggtttcaagtcgtccttgctgtctgat
gatggaaacttctctctggtggattcctacccatataaccaagagagagaaatctacaga
tggaatagtataactccagtcacaaatgtgtttaattcaaatgtggagagaagctatacc
tattggaattatcagataggttttgacaatgtagatgctcagtgtcctgtttccttgaac
aactatccatttggacaaaggagagatgaaaatggaaagggtgaaacctgtttaaccagt
acttccagaagattcagcataggacctacctggccaaacagccctggacatgacaaagag
attacaagttggtctatccagctgattaaggcagatcaagggagtaatgaaaatgtgatt
tctttttgcaatacagtggagaaaataagaaacgcctatcctgcttgtgatttgaagacc
aacagtgggaagatctggagtgttgtaacaaagttcccagacaacattcttggtaaaaca
agattcagaatcagcatctggacagattcttcaccatctcctctgcttcttacacaacat
gctggatgtatcactcatgacttaattgtggagatccttcgttgcacaaatcaataccca
gtccatgaagaatgttttctaagtgtttgtggctctgatgaagtcttacaaaataatcat
agtttgggcagccacgagagtcttcgcaaagcaacaactgatattcatcttcatctacac
accactacaaatttgaagcaaagtttggctcgaatgcacgaggatgaccaaaacaagttc
agtgtgaatgagctgttagaatatacttgtgcttggagactgactcgacagaaccttgtt
gcagctcttaggaaatacagaggtcaagtggagcatcttttgcaaaatgagccacataat
gttgattatgtgattgaagtaactaaagaaatctgcagtgttctgtgcttcgtggaaacc
agagaaattaccaatgctgtcaagaaactccgtgcagtgccattggtaaaaacacaggat
tcacttcaacgggtggaagcacaagctttaatggaagctgctgtgacagagctctccatg
gccatctcccatctcattcatgtgtacagcagcagcattgatacagatttccaggttgcc
aatgcacctagaagcccttcacatgcagacatcagccttgattctcagcttagcttcact
gtttacgctgctcataatattcctgaagcctgggtgaacaggtacaaagttttttctttt
tcctgtttacttacatatgctggaaagacaatatgtcaagtgaagatttgcaaaaatata
cctattagaaaatccttttttttcctgacagactggaatgagaaaatcaactttcctcta
cggataaaggctctcccaagggaaacaatgctgacaataaaactacttggactaaacagt
gcttctaaaactacagaggtgcttgcctggacatgttgcccattgtatcaaaaagagcag
ctcattcacggaactgtgctgcttagcatgaagttgtacagcatgctcccagcagcaatg
attaccccaggcatctgtagtactgatgcaccaacgtcagtaatgttgcagtttgaattt
cctgaaactgatttgaagttcattaaccctgaacctgaagagagaagagatgatcttgaa
gagccaactgaagagtgcctgaagcatattgcaagactttcacaggcacattctctcttg
ctactctcggagcaacagaaaagaatcttatggttttatcgttactactgcaataatcaa
aattgctcccttcctctggtactgggcagtgcacccagctgggatcgaacaactatgtca
gaaatgtattccgtcatgagaaaatggagattttctaaccctgtggaagcacttggactt
ctaactttcagttttccagataaagatattcgcagaacagcagtgcagcaaatagaaaat
ctgtcaaatgatgaattgttagaatacctcccacagctggttcaggtgctcaagtttgag
tggagtctggaaggccctttggtgaaactcctgctgaatcgctctcttcagagcatccaa
gtagcgcatcaactttattggctgttgaagaatgcacagaatgaagttcatttcaaaacc
tggtatcggaaattactggctgctctccagttcactgctgggaaaaccttgagcaatgaa
ttttctaaggaggagaaacttaacagaattttggaagatattgctgaaaaagtaaaagct
gccagtgacacaaaaagaaaggaggtgttaaagatggaactcaatagacttcagcagttc
ttccaagaggtaaaagtttgccgacttcctctgaaccctgcacttgttgtacaaggcata
gaggcagattcgtgttcatattttacatccaatgcttttccattaaaaatctccttcatc
aatgcaactgctccaagtggaaatatcaatattatttttaagataggtgatgatctacgt
caggatatgctggttctgcaaattattcgagtgatggacaacatatggctccaagaaggt
ctggatatgcaaattataatctatagatgtttatctacaggaaaaggccaaggacttgta
cagatggtgccagatgctaccacactagccaagatccacagggaatccggacttatagga
ccactgaaagaaaacacaattaaaaaatggttccgtcatcaccatcgtctggaatccagt
taccaagaggcaataaggaatttctttcattcctgtgctggctggtgtgttgtcaccttc
attctaggagtctgtgaccgacacaatgacaacataatgttgacaaatgctggacacatg
tttcatattgattttggaagatttttaggtcacgcacagacatttggaagtataagaagg
gaccgagctcccttcatcttcacatcagagatggagtatttcatcacagaaggtggaaaa
aacccacagcgttttcaagagtttgtggagctttgttgtcgagcatataatatagtcagg
aaacacagccagttactcttaaacctgctggagatgatgctgcatgcaggattgcctgag
ctgaacagcattcaggatttgaaatatgtgtatgataacctccgtcctcaggactcagac
ctccaggccaccagctactttaccaggaaaataaaggaaagtttagagtgctttcctgtc
aagctcaataacttgatccacacgcttgcacacatgtcactgaccagctctacaaagctt
ccgtctcaagagactgtccctcaagaatggatgatgctgaatgcagagaagtcaattgca
agagccaccattttggggttcaacaaaaagtctgactatctatatctagtccaggtggtg
caaacctgcaatgtggtcacttttgtggagaaatcgtttgaccagttctcagaacttcac
agcaatctccagaagcagtttccatcacatacactcccagagtttccccactcatggcat
ataccttttacagatcttgaacataagagagtgaaggatttgaatctctacctgaagcag
ctattaaatggatccagaaaactagcaaacaatgagcttgtactcagattcttcttgaat
tggtccaaacataccttgacggaaacagcatcatctgtgacatcaggtcctcagtcaact
gatggtacacctggagtgcagttagtcatatcatatgagggcactcatctgacagtgatg
ttgaaacacatgaggaacattcgcctcccagatggctctgccccaagtgtgcatgctgaa
ttctatcttctgccagatcctgatgaggtcaatcgaaggaaaacaagaacagttccaaaa
accaccaaccccactttcaatgaaattgttgtgtacaacaaagttatgcaacttgaaggc
cgtatactgaagcttgttgtgaaaagcaaaggaacatttgtgggagctgttaacattcaa
ctgagtagagtccatttaaatgaagaaaaatggtatccactgggaaacagtatattttaa

DBGET integrated database retrieval system