KEGG   Coturnix japonica (Japanese quail): 107316546Help
Entry
107316546         CDS       T04297                                 

Gene name
NOP58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    107316546 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cjo03009]
    107316546 (NOP58)
Ribosome biogenesis [BR:cjo03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    107316546 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT RNA_polI_A34 tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 107316546
NCBI-ProteinID: XP_015723679
Position
7
AA seq 527 aa AA seqDB search
MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS
TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI
RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRRNFASSDVSDILPEEIEEDVKAAAE
ISMGTEVSEEDINNIIHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMVGELVGARLI
AHAGSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKFGLIYHASLVGQTTAKNKGKIS
RMLAAKTALTIRYDALGEDSSAEMGAENRLKVETRLRHLEERGIRRISGTGKALARADKY
QNKSEIKVYDPSSDSTLPAVSKKRKIEEVEEQEAGVAVKAKKFKAEMKEEANVEEDEPVK
KKKKKKEKKKQAEEEEDLTEEAPTSSTVENTEKKKKKKKKVKNENED
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgagaccgctgccggctacgccatcttcaaggttctgaatgagaaa
aaactccaagaagttgacagtttgtggaaggagtttgaaactcctgaaaaagcaaacaaa
atagtaaagctgaaacactttgaaaagtttcaggacacaacagaagcgctcgctgcatcc
acggctcttgtagaaggcaaactcagcaagaacttgaagaaaattctcaagaagatagtg
gcaaaagatgcccacgaacagttggctgtagcagatgctaaacttggtggtgtcataaag
gataagctgaatttgagttgtatacacagcccgatggttacagagctgatgagagggatt
cgttcacagattgaagggcttattacaggcctcccttccagagagatggcagctatgtgt
ctgggtctggcacacagcctttctcgatacaagttgaaattcagcccagacaaagtagat
accatgatcgtccaggcaatttcacttcttgatgacttggacaaagaactgaataattat
atcatgcgctgtagagaatggtatggttggcacttccctgagctgggtaaaatcatcaca
gataacctgacctattgtaaatgcgtgcggaaagttggagatagaagaaattttgcatct
tctgatgtttctgacatcctaccagaggagattgaggaggatgtaaaagctgctgctgag
atttccatgggaacagaagtatcagaagaagatataaacaacataattcatctctgtgat
caggtaattgagatctctgagtatcggacacagctgtatgactacctgaagaacagaatg
atggccattgctcctaatctcaccgttatggtgggtgaactggttggagcaagactcatt
gctcatgcaggttctctcttgaatctggcaaaacatccagcctcaacagttcagatattg
ggtgctgagaaggcactcttcagagcactcaagactaaacgagacacacctaaatttggc
cttatctatcatgcttccttagtgggacagacaaccgccaaaaacaaaggaaagatttct
cgaatgctggcagctaagactgccttgactattcgttacgatgcccttggagaggatagc
agcgctgaaatgggagctgagaacagattaaaagtggagacaagactgaggcatttggaa
gagagaggaataagaagaataagtggcactggaaaagccttggcaagggcagacaagtat
caaaacaagagtgaaataaaggtgtatgatccttccagtgactctacgcttcctgctgtt
tcaaagaaacgcaaaattgaggaggtggaagagcaggaggcaggagttgcagtgaaagca
aagaagttcaaggcagagatgaaagaagaggcaaatgtagaagaggatgagcctgtcaaa
aagaagaaaaagaaaaaggagaagaaaaaacaagctgaggaagaggaggacctgacagag
gaagcgcccaccagctctacagttgagaatacagagaaaaagaagaagaagaagaagaag
gtgaaaaatgagaatgaagactga

DBGET integrated database retrieval system