KEGG   Coturnix japonica (Japanese quail): 107316818Help
Entry
107316818         CDS       T04297                                 

Gene name
DDX18
Definition
(RefSeq) DEAD-box helicase 18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjo03041]
    107316818 (DDX18)
   03009 Ribosome biogenesis [BR:cjo03009]
    107316818 (DDX18)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107316818 (DDX18)
Spliceosome [BR:cjo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    107316818 (DDX18)
Ribosome biogenesis [BR:cjo03009]
 Eukaryotic type
  90S particles
   Helicases
    107316818 (DDX18)
  Pre-60S particles
    107316818 (DDX18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII PCM1_C Cwf_Cwc_15
Motif
Other DBs
NCBI-GeneID: 107316818
NCBI-ProteinID: XP_015724216
Position
7
AA seq 639 aa AA seqDB search
MSVSVAAGNLPMRLLRRKIHKRNLKLRQRNLKLRAAEQEGQASLAPPEEDEGVKEAAAPE
AEAETEASGQAAPGAETAETKRRKKKKRKAAAGPEEGSETKKAKAEEDVSVEAEDEDGQG
SGEKEAEEEDEVPSLPLGLTGAFEDNSFTSLAGLVSESTLKGISDMGFTHMTEIQHKSIK
PLLEGRDILAAAKTGSGKTLAFLIPAVELIYKLKFMPRNGTGVIILSPTRELAMQTYGVL
KELMNHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLV
IDEADRILEVGFEEEMKQIIKLLPKRRQTMLFSATQTRKVEDLAKISLKKEPLYVGVDDN
KETATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKYHYELLNYIDLP
VLAIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIH
RVGRTARGINGRGHALLILRPEELGFLRYLKQARVPLSEFEFSWSKISDIQAQLEKLIEK
NYFLHKSAQEAYKAYIRAYDSHSLKQIYNVGNLDLNKVSLSFGFRVPPYVDLNVNSNQGR
RLQKRGGGGGFGYQKPKSVHKAKIFKHISKKSDNRQFSR
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgtcggtggccgcgggcaacctgcccatgcggctgctccgcaggaagatccac
aagaggaacctgaagctgcggcagcgcaacctgaagctgcgggctgccgagcaggaaggt
caggcttcgttggcccccccggaggaggacgagggggtgaaggaggcggcggccccagag
gcggaggcagagacagaagcgagcgggcaggcggcgccgggcgccgagaccgcggagacg
aagaggaggaagaagaagaagaggaaagctgctgctggccccgaggaaggttcagaaact
aagaaagcaaaagctgaagaagatgtatctgtggaggcagaagatgaagatgggcagggc
tcaggagagaaagaggcagaagaggaggatgaagtgcccagtttacctctgggtctaaca
ggtgcctttgaagacaattcttttacttcccttgctggtcttgtcagtgagagtacattg
aaaggtatcagtgatatgggctttacacacatgacagaaattcagcataaaagcattaaa
cctcttctggaaggcagggatattttagcagctgccaaaacaggcagtggcaaaacactt
gcatttctcattcctgcagtagagctcatctacaagttaaaattcatgcctagaaacggg
acgggtgttattattctttcacctactcgagagcttgccatgcaaacctatggagttctt
aaagaacttatgaatcatcacgttcacacctatggtctgatcatggggggcagtaacaga
tcagcagaagctcagaaacttggaaatggaatcaacatcattgtagcaacaccaggaagg
cttctggatcatatgcagaacactccaggtttcatgtacaagaacttacagtgtttggtg
attgacgaggcggatcgaatcttagaggttggatttgaggaagaaatgaaacagatcata
aaacttctaccaaagcgcagacagacgatgctgttttctgctacacaaaccaggaaggtg
gaagatctagccaagatttctctgaagaaagaaccactgtatgtaggagttgatgataac
aaggagacagcaacagtagatggccttgaacagggctacgtagtgtgtccatctgaaaaa
agattccttctgctcttcacgttcctgaagaaaaaccggaagaagaaactaatggtattt
ttttcttcatgtatgtcagtgaagtaccactatgaattactcaactacattgatttgcct
gttttggccattcacggcaagcagaaacaaacaaaacgtactacgacgttcttccagttc
tgtaatgcagaatctggaatcctattgtgcactgatgtagctgccaggggactagatatt
cctgaggtggactggattgtccagtacgaccctccagatgatccaaaagagtatatacac
cgtgttggtagaactgccagaggtataaatggtagaggacacgctctgctcattttacgt
ccggaagaactgggctttctccgttacctgaaacaagccagggtaccactcagtgagttt
gaattttcctggtcgaagatttcagatattcaggctcagctggagaaactgatcgaaaag
aactacttccttcacaaatcagcccaggaagcatacaaagcttacattagagcttatgac
tctcattctctgaagcagatctataacgtggggaacctggatcttaacaaagtcagcctc
tcctttggctttagagtccctccatacgttgacctcaatgtgaacagcaaccaaggcaga
agactacagaaaagaggtggaggtggaggatttggttaccagaaaccaaagagtgtccac
aaagctaaaatcttcaagcacattagcaagaaatcagacaatcggcagttttctcgttaa

DBGET integrated database retrieval system