KEGG   Coturnix japonica (Japanese quail): 107317709Help
Entry
107317709         CDS       T04297                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjo04131]
    107317709 (DOCK7)
Membrane trafficking [BR:cjo04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107317709 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 107317709
NCBI-ProteinID: XP_015726168
Position
8
AA seq 2140 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPIDL
EDYLNTHPITVESGPLRDLLEFPPDDIEVVYTPRECRTLVSAVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYHDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSNRHKELFALHP
APDEEEPIERLSIPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKESDAAKNKEKLEKLKCQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHG
RNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMV
HHLYFADKLDASRKNRFPERFMDDVNALVSTIAGDIVSRFQKDTEMVERLNTSLAFFLND
LLSVMDRGFVFGLIKTCYKQVSSKLYSLTNPSNLVSLRLDFLRIICSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVAMLYLPLIGVIMETVPQLYDFT
ESHNQRGRPSCVTADDYEGESGSMISQTVAMAIAGTSVPQLTRPSSFLLTSSSGRQHSTF
STESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSHKPARSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESI
LGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSS
SISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTI
LTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNS
PDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISS
NVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIP
IHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGTKFGDLDEQEF
VYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVEPYF
DTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRI
NVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEV
AQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHR
LKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDI
NT seq 6423 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcgcagaagatcagcagaaccgtggcggctgaagtcagg
aagcagatctcagggcagtatggagggtctccccagcttctcaaaaacctcaatatcgga
ggcagcgtctctcatcacacaactgtgccactcacagaagcagtggaccccattgatttg
gaggactaccttaacacacaccccattacagtcgagtctggccccttgagggacttgctg
gagtttcctcccgatgacatcgaggttgtgtacaccccccgagaatgtcgaacgcttgtg
tcagctgttcctgaagagagtgagatggaccctcacgtgagggactgtgtgagaagttac
acggaagactgggcaattgtgaacagaaagtatcacaaactggggactggatttaatccc
aacactttagacaaacagaaggagaggcaaaaggggctccccaaacaggtctttgagtct
gatgaagctccagatggcaacagttaccacgatgaacaagatgaccttaaacggcgctca
atgtcgattgacgatactccccggggcagctgggcttgcagtatttttgatctgaagaac
tcccttccagatgcccttctcccaaacctactggaccgaaccccgaatgaagagattgac
caccacaatgaagatcagagaaagtccaataggcataaggagctttttgcactacacccg
gcaccggatgaggaggagcctatagaacgacttagcattcctgaagtacccaaagagcac
tttggccaaagactgctggtgaagtgtttgtctcttaaatttgagatagaaattgagccc
atttttgcaagtttggctttgtatgatgttaaagagaagaaaaagatttcagaaaatttc
tactttgatttaaactccgaacaaatgaagggaatgctccgtccacacgtcccccctgct
gctatctccacactggccaggtctgccatcttttcaatcacctacccctctcaagatgtg
tttctggtaataaagcttgaaaaagtattacagcagggagatattggggaatgtgctgag
ccttacatgatttttaaagaatccgatgcagcaaagaataaggaaaagttggaaaaactg
aaatgccaggcagaacagttttgccaaagactaggcaaataccgaatgccttttgcatgg
acagccattcatttaatgaacattgtgagcagcgctggaagtttggaaagagattccaca
gaagtagaagttggcacaggagaacgcaaaggatcatggtcagagagaaggaattccagt
attgtcgggaggcgttccttggagagaaccacaagcggcgatgaggcctgcaatttgacc
agttttagaccagctactctgacagtgacaaacttctttaagcaggagggtgatcgcctg
agtgatgaagatttgtacaagttcctggctgatatgagacggccgtcatcagtgttacgg
agattgagacctatcacagctcaattaaagatagacatatctccagctccagagaatccc
cattactgtctaactccagagctgctgcaagtcaaactttacccagacagcagagttcga
cctacaagagaaatcctggagtttcctgccagggatgtctacgttccgaataccacatac
aggaatcttctttatgtctatcctcagagccttaactttgccaaccgccaaggatctgcc
aggaacatcactgtgaaagtccagttcatgtatggagaggacccaagcaatgctatgccg
gtcatctttggcaaatctagctgtcctgagttttccaaagaagcatacacagctgtagta
tatcacaacaggtcacctgattttcatgaggaaatcaaaattaagcttccagccacttta
accgatcaccaccatctgctttttactttctaccacgtcagctgccaacaaaaacaaaac
actcccctggagactccagttggatacacctggattccgatgcttcaaaatggacggtta
aagactggtcagttctgtctccctgtttcattggaaaaaccaccacaggcgtattcagtg
ctttctccagaggttccgcttcctggaatgaagtgggtggataatcacaaaggagttttc
aatgtagaagttgttgctgtatcatccctccacactcaggacccttatcttgacaagttc
tttgcacttgtccatgctctggatgagcacatgttccctgtgcgaataggagacatgaga
attatggaaaacaacttggaaaatgaactgaagagcagcatttcagctttaaattcctct
caactggagccggtagtgcgatttcttcatctcctgcttgacaaactgattcttctggta
gtaagacctcctgtcattgcaggccaaatagttaacctgggccaagcatcttttgaagca
atggcttcaatcataaacagacttcacaagaacttggatggaaaccaggaccagcacggc
agaaacagccttcttgcttcctatatttattatgtttttcgcctaccaaatacctatccc
aactcaccatcaccaggtcccggtggcttagggggatcagtgcattatgccaccatggct
cgatctgctgtccgacctgcaagccttaacctgaaccgctcacggagcctcagcaacagc
aacccagatatatctgggacccccacctcacctgatgatgaagttcgctcgatcattggc
agtaagggtttagaccgctccaattcctgggtaaacactggtggtccaaaagcagcccca
tggggatccaaccccagcccaagtgcagaatcaacacaggctacggatcgaagttgtaat
cgtatgtcttcgcacactgagacgtcaagtttcttacaaacattaacaggacggttacca
actaaaaagctttttcacgaagagctggccttacagtgggtcgtgtgcagtgggagcgtg
cgggaggcagccctgcagcaggcctggttcttcttcgagctgatggtgaagagcatggtg
catcatttgtattttgctgacaaactggatgcttcgagaaagaatcgttttcctgagcgt
ttcatggatgatgtaaatgctttggtcagcacaattgctggtgatatagtctctcggttt
cagaaggatacagaaatggttgaaaggctcaacaccagtcttgcatttttcctcaatgat
ctattgtctgtcatggacagaggatttgtttttggtcttattaagacctgctacaaacag
gtgtcttcaaagctgtattccttgacaaacccaagtaacctggtatctttgaggctggac
ttccttcgcatcatttgcagccatgaacactacgtcaccttgaatttaccctgcagcttg
ctcacaccgcctgcatctccatcgccgtctgtgtcttcagcaacctcccagagttctggg
ttctccacaaatgtccaagaccagaagattgcaaatatgtttgaattgtctgtgcctttc
cgacagcagcattacttggctgggcttgtgttaactgaactggctgtcattttagatccc
gatgcagaaggtttatttggattgcataagaaggtcatcaatatggtacacaacttactg
tccagtcacgactcggacccgcggtacgctgacccgcaggtaaaggcccgggtggcaatg
ctgtatctacctctgattggtgtgatcatggaaacggtgcctcagctctatgactttaca
gagagtcacaatcagcgagggaggccaagctgcgtcactgctgatgattatgaaggcgag
agtggaagcatgataagccagacagttgctatggccattgcagggacatcggtccctcag
ctcaccaggcccagcagttttctactcacctcatcgagcggcaggcagcactccaccttc
tcaacagagtccagccgcagccttctgatctgtctcttgtgggtgctcaagaatgcagat
gaaagtgtcttacagaagtggttcacagacctgtcagtgctgcagctcaatcgcctgctg
gatttgctttatctttgcgtatcctgttttgaatacaagggcaagaaagtgtttgaaaga
atgaacagtctgacgttcaagaagtcaaaagacatgagagccaagcttgaagaggctatt
ttgggaagcataggagcaaggcaggaaatggtccgaagaagcagaggacaattagagaga
agcccttctgggagtgcttttggaagtcaagagaatttgagatggagaaaggatatgact
cactggcgtcaaaacacagagaagcttgacaaaagccacaaaccagccagatcacgagca
gagatagaacatgaagcacttattgatggaaatcttgcaacagaagcaaatctaattatt
ttggatacactagagatagttgtacagactgtttctgtgacagagtccaaagagagtatc
ctcggcggggtgctgaaggtgcttctgcacagcatggcctgcaaccaaagtgcactttat
ctccaacactgcttcgcaacacagagagctttggtctcaaagttccccgagctgctgttt
gaagaggagactgagcagtgtgcagatctgtgcctgaggctcctgagacactgtagcagc
agcatcagcacaatacggtcacacgcgagtgcctcgctctacctactgatgaggcaaaac
tttgagattgggaacaactttgccagggtgaaaatgcaggtgacgatgtctctctcatcc
ctggtggggacatcccagaattttaatgaggaatttttacgacgttccttgaagactatt
ttaacatatgctgaagaagatctggaacttagagagacaacatttcctgatcaggtccaa
gatctagtgttcaacctccacatgatcctctctgacacagttaaaatgaaggagcaccag
gaggatccagaaatgctaattgacctgatgtacaggattgcaaagggctatcagaattcc
cctgacctgcgcttgacctggttacagaacatggctggaaagcactcggagaggagcaat
catgcagagtcagcacagtgcttggtccactctgcagccttggtggctgaatatctgagc
atgctcgaggaccgaaagtacctccctgtaggatgtgttacatttcagaacatatcttct
aatgttttggaagagtcagcagtttctgatgatgttgtgtcaccagatgaagaaggaatc
tgttctggaaagtacttcacagaagcaggtctggtgggactgctggagcaggcggcagca
tctttctccatggctggcatgtacgaagcagttaatgaggtttacaaagtccttattcct
attcatgaagctaacagagatgccaagaagctatctactattcatggtaaactccaggaa
gcgtttagcaagatcgtccaccagagtactggctgggaggatggaaagaggatgtttggc
acctacttcagggtcggtttctatggaaccaagtttggagacctggatgaacaagagttt
gtttacaaggagcctgcgataacaaagttagctgagatctcccataggcttgagggattt
tatggagaacggtttggtgaagatgtgcttgaagtgatcaaggactcaaaccctgtggac
aagtgtaaactggatcccaacaaggcctacatccagatcacctacgtggagccttacttc
gacacgtatgagatgaaggacagaataacttatttcgacaaaaactacaacctgcggcgc
ttcatgtactgcacgcccttcacgctggacggccgagctcatggggagctgcacgagcag
ttcaagcgtaaaaccatcctgacgacgtcccacgctttcccttacatcaaaaccaggata
aacgtcattcacaaagaggagatcattttgacgcccattgaagttgccatagaagacatg
cagaagaaaacacaagaattagcttttgcaactcaccaagaccctgcagacccaaagatg
ctgcagatggtgctacagggatcagtaggtaccacagtgaatcagggaccattagaagtt
gcacaagttttcttatctgaaatacccaacgacccaaagctcttcaggcatcataacaaa
ctgcggctctgtttcaaagacttcacaaaaagatgtgaggatgctctgcgcaagaacaag
agcttgataggcccggaccaaaaggaatatcagcgagagctcgaaaggaattaccaccgg
ttaaaggaagctctgcagcctttgataaacaggaagatcccacagctgtacaaggccgtg
ctgccagtcacctgccacagagactccttcagcaggatgagcctccgcaaaatggatatc
taa

DBGET integrated database retrieval system