KEGG   Coturnix japonica (Japanese quail): 107318330
Entry
107318330         CDS       T04297                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X2
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107318330 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjo03000]
    107318330 (MECOM)
Transcription factors [BR:cjo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107318330 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 Zn-ribbon_8 RGS12_us1 zf-met PyrI_C SET
Other DBs
NCBI-GeneID: 107318330
NCBI-ProteinID: XP_015727478
Position
9
AA seq 1274 aa
MHLMAPMSRTNPAAKGAPGDAELCHAVLGPRGVHQWTFFPSECDECLYESFPELPLEEVP
EADGEAANAQCPASVSIQEPSSPTTSSEAFTPKESSPYKATIYIPDDIPIPSEFELRESN
IPGAGLGIWTKRKIEVGEKFGPFVGEQRPHLKDPSYGWEILDEFCNVKFCIDASQPDVGN
WLKYIKFAGCYDQHNLVACQISDQIFYRVVADIEPGEELLLFMKSEDYSHETMAPDIHEE
RQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQKKLENENDLRDVHEIQECK
ECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAK
VFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYT
QFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLP
GTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLL
PTSSPVKGLPSADQTNKSQSPLMSNPQILPATQDILKALNKQPSVGENKPVELQPERSSE
ERPHEKLSDQSESSDLDDVSTPSGSDLETTSGSDLESDIESEKEKYKENGKMFKDKVSSL
QSLASINNKKEHSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKV
GALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQSPSELKKIPKGSSESPFDLTT
KRKEEKPVTPIPSKPAAPPAASQDQPLDLSMGSRSRASSTKQAEPRKNHVFGEKKGGDLE
QRKTSEASLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQR
IWMSAIENMAEKLENFSALKPEANEMIQSMPSMFNFRAPPSALPETLLRKGKERYTCRYC
GKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRC
FGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHNN
QSPRNSEERMNGSHFKDEKAMVTSQNSDLLDDEEAEDEVMMDEEDEESEIAGKTVKEPVT
SDIHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGLSALDHIRHFTDSLKMRKMEEN
QYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDKDSLHSASHNSPNMWHSMAR
AAAESSAIQSISHV
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgcatctgatggctcctatgagcagaacgaatccagcagcaaaaggagctccaggagat
gcggagctgtgccatgcagtgcttggaccacgtggcgttcatcagtggacgttcttccct
tcagaatgtgatgaatgcctgtatgaaagctttcctgagcttcccttggaggaagtgcca
gaagctgatggagaggctgcaaacgcccagtgcccagcatctgtcagcatccaggagccg
tcctctccaaccacctccagcgaagctttcacaccaaaggagagctctccttacaaggct
acgatatacattcccgatgacattcccattccttctgaatttgagctccgagaatccaac
attcctggagcaggattagggatatggaccaaaaggaagattgaagtaggagaaaagttt
ggccctttcgtaggagagcaacggccacacctcaaagatcccagttacggttgggagatc
ttggatgagttttgcaatgtgaagttctgcatagacgccagccaaccagatgtaggaaac
tggctcaaatacatcaagtttgctggatgctacgatcagcacaaccttgttgcatgtcaa
ataagtgatcagatattctacagagttgtggcagacattgagccaggagaggagctatta
ctgttcatgaagagtgaagattattcacatgaaacaatggctccggacattcacgaggag
cgccagtatcgctgcgaggactgcgaccagctctttgagtccaaggctgagctggtggac
caccagaagttcccctgcagcacaccacactctgcattctccatggtggaggaggatttc
cagaaaaagcttgagaatgagaacgatcttcgggatgtgcacgaaatccaggagtgtaaa
gagtgtgatcaggtcttcccggacttacaaagcctggagaagcacatgctgtcccacagc
gaggagcgggagtacaagtgcgaccagtgccccaaagctttcaactggaagtccaacttg
atacgtcaccaaatgtcgcatgacagcggcaagcactacgagtgtgagaactgtgccaag
gttttcacggaccccagcaacctccagaggcacattcgttcccagcatgttggggctcgt
gctcacgcttgtccagagtgtggcaaaacgtttgccacatcttcaggcctcaaacaacat
aaacacatccacagcagtgtcaaaccctttatatgtgaggtctgccataaatcctatact
cagttttcaaacctttgtcgtcataagcggatgcacgcggactgtcgcacccagatcaag
tgcaaggactgcgggcagatgttcagcactacctcctctctcaacaagcaccggcgcttc
tgcgagggcaagaaccattttgcagcaggaggattttttggtcaaggcatttcacttcct
ggaaccccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggcctt
gctgactattttggagccaataggcatcctgctggtcttacctttccaacagctcctgga
ttttcttttagcttccccggtctgtttccttcaggcttgtaccacaggccacctttgcta
cctactagctctcctgttaaaggactaccaagcgcagatcagacaaacaaaagtcaaagt
cccctcatgagcaaccctcagatactgccagccacccaggatattttgaaggcactaaat
aagcaaccatctgtaggggaaaataagccagtggagcttcaaccagagaggtcctctgaa
gagaggccgcatgagaaactcagtgaccagtcagagagtagtgaccttgacgatgtcagt
acccccagtggcagtgacctggaaaccacctctggctctgatctggaaagtgacattgaa
agtgagaaagagaaatataaagaaaatggtaaaatgttcaaagacaaagtaagctctctg
cagagtttggcttcaataaataataagaaagaacacagcaatcattccattttctcacca
tctttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctattgct
tctattgctgaaaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagtt
ggagccttaccttacccttccatgtttcccctcccattttttccagcattctctcaatca
atgtatccatttcctgatagagacttgagaccgttacccttgaaagtggaaccccaatca
cccagtgaactcaagaagatcccaaagggaagctctgagtctccctttgacctcaccact
aagcgtaaggaggagaagcccgttactcccataccctcaaagccagcagctccgcctgcg
gcaagccaggaccagcctctagatctgagcatgggcagtagaagtcgagccagcagcaca
aaacaggcagagccccggaaaaaccacgtctttggtgagaagaaaggaggtgatctcgag
cagaggaaaacgtcggaggcctctttgcagcacgcccgaccgactcccttctttatggat
cccatttacagagtagagaaaagaaagttaactgacccactcgaagctttaaaagagaaa
tacttgagaccttccccgggattcttgtttcatccacaattccaattgcctgatcaaaga
atttggatgtcagctatagaaaacatggctgaaaagctggagaatttcagtgctttgaaa
ccagaggccaatgagatgatccagtcaatgccatccatgttcaacttccgagccccgcca
agtgctctgcctgagaccctcctgcgcaagggcaaggagcgctacacctgcagatactgt
ggcaagattttccccagatctgcaaacctaacccgtcacctgaggacgcacactggagag
cagccctacagatgcaaatactgtgacaggtcctttagcatatcttccaacctgcagaga
catgtccgtaatatccacaataaagagaagccattcaagtgtcacttgtgtgacaggtgt
tttggtcaacaaaccaatcttgacagacatctaaaaaagcatgagaatggcaacatgtct
ggtactgcaacatcttcacctcactcagaactggaaagcacaggggccatcctagatgac
aaggaagactcttactttacagaaattaggaattttattggaaacagcaaccataacaat
caatccccccgaaactcagaggagagaatgaatggcagccactttaaggatgaaaaagcc
atggtaaccagccagaactcagatttgttggatgatgaagaggcagaagatgaagtaatg
atggacgaagaggatgaagaaagtgaaattgcagggaaaacagtcaaagagcctgttaca
agtgacatacacgaggggactcctgaggaggattatgaggaaacgagtactttggacatg
aactgcaaagcttcccctggcaggtataaagaggaggaatataataagactggactttca
gctttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaat
caatatagtgaagctgaattggcagctttcaatacttcccagctgccagaggacctaaaa
caaccattgtacaggaaatccaaatcccaggcgtacgccatgatgctctctctctccgac
aaggactcccttcattctgcatcccacaattctcccaatatgtggcacagcatggcgaga
gctgctgcagaatccagtgccatccaatccatcagccacgtatga

DBGET integrated database retrieval system