KEGG   Coturnix japonica (Japanese quail): 107319047Help
Entry
107319047         CDS       T04297                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107319047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjo04030]
    107319047
G protein-coupled receptors [BR:cjo04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107319047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv CD34_antigen
Motif
Other DBs
NCBI-GeneID: 107319047
NCBI-ProteinID: XP_015729044
Position
11
AA seq 335 aa AA seqDB search
MNQAEESRIHVTWNTVKLVVCVILSLSFIIGTPGNCIVIWTVCTKMKQVSPSVLLILNLA
IADILVLITLPIWIYSFADSWVFGITFCKILVFIIYCSMYASIFLITALSLERLMAVFYP
FAVQRYKTKEKTTIIMVFIWFLSIAFGVSIIPFQETDVINGGQQCTCRNYSSIKQKVSYL
LLETLVGFVIPFLIICISYVCVAKRISKMTYQSKQRSERLIASIVVAFILCWFPHHLFNI
LDIILIEIEHSEETYLTLEIIIDIGEYISGALVFVSSCINPLLYAFAARKFQNHLRIAKI
SKLFEQMSQTVTDEDKKKSHSVAKPETVSVGMENL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagctgaggaaagcaggatccacgtgacatggaacactgtgaagctggtagtt
tgcgtgatactgagcctgtcatttattattgggactcctgggaattgcattgtcatctgg
actgtttgtactaaaatgaaacaagtgtctccttcagtcctgctgatcttgaacctggcc
attgcagatatcctcgtactcattactttgcctatctggatttactcctttgctgactca
tgggtttttggaataaccttctgcaaaatactggtcttcattatttactgcagcatgtat
gctagtatatttctgattacagcactgagcttggagagattaatggctgtcttttaccct
tttgctgttcaaagatacaaaacgaaggaaaagactactataatcatggtcttcatttgg
ttcctgtctatagcttttggtgtttctattattccatttcaagagacggatgtaatcaat
ggtggacagcaatgcacgtgtcgcaactactcttctattaaacagaaagtgtcgtatctt
ttgctggaaactcttgtaggttttgtaattccttttttaattatatgcatctcttatgtg
tgtgttgcaaaaagaataagcaaaatgacttaccaatcgaagcagcgatcagagcggctg
attgccagcattgtggtggcattcattttatgctggttccctcaccatcttttcaacatc
ctagatattattttaatagagatagagcactctgaggaaacgtatttgactctggaaata
attatagacataggagagtatatctctggagcacttgtgtttgtcagtagctgcattaat
cctctactttatgcttttgctgcacggaaatttcagaatcacctgagaattgccaagata
tcaaaactctttgaacagatgagtcagactgtgacagacgaagacaagaaaaagagtcat
tccgtagccaaaccagagactgtttcagtaggcatggaaaatctctaa

DBGET integrated database retrieval system