KEGG   Coturnix japonica (Japanese quail): 107319387Help
Entry
107319387         CDS       T04297                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00232  Caffeine metabolism
cjo00983  Drug metabolism - other enzymes
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    107319387
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107319387
Enzymes [BR:cjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     107319387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 107319387
NCBI-ProteinID: XP_015729623
Position
11
AA seq 296 aa AA seqDB search
MNIQEYFSRISFDGSHKDADLQTLTAIFQHHIQAIPFENLSMHCGETIDLDLQSTYNKIV
KKKRGGWCMETNYLLFWALQEMGYDVCILGGKSYDPAKKAYIDQINHILLKVVIKGSSYI
VDAGFGGGPYQTWLPMLLISGKDQPQIPGIFRFTEDNGIWYLEKVKRKHYVPEGSVPLTD
TPEMGNIRKLYSFTLEPKHIDDFQELNTYLQVCPDTILQKKSICSLQTTEGFYALVGWTF
SDMKYKYKEDTDLLQTTTLTDEEVEKTLKDKFNIVLENKLIPVNVRGLPPNLVDTI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaagagtatttctcaagaatttcttttgatggctcccataaggatgcagac
ttgcaaaccttaacagccatcttccagcatcacatccaggcgattccttttgaaaacctc
agcatgcactgcggagagacaattgacctggatttgcaatctacttacaataagatcgtg
aaaaagaagcgtggtggatggtgcatggaaacaaactaccttttattttgggctttgcaa
gaaatggggtatgacgtctgcatccttggaggaaagagttatgacccagcaaagaaggcg
tacatcgatcaaataaatcacatcctactgaaggttgtgatcaagggaagttcctacata
gtagatgctggttttggtggtggtccctaccaaacatggctgccaatgttgctgatttct
gggaaggatcaaccccagattcctggcatcttccgcttcacggaagacaacggcatctgg
tacttggagaaagtcaagaggaaacattatgttccagagggaagtgttcctctcaccgat
actccagaaatgggcaatatcagaaaactatattcattcactcttgagccaaagcacata
gatgacttccaggagctaaacacatacctacaagtgtgtccagacaccatacttcagaag
aaatcaatatgcagcctccagaccactgaagggttttatgccttagttggatggaccttc
tctgacatgaagtacaaatacaaagaggacacagacctgctgcagactacaaccctcaca
gatgaagaggtggagaagacactgaaagacaaattcaacatagtgttagagaacaaattg
ataccagtaaatgttcgtggcttgccacctaatctggtggataccatataa

DBGET integrated database retrieval system