KEGG   Coturnix japonica (Japanese quail): 107319894Help
Entry
107319894         CDS       T04297                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00561  Glycerolipid metabolism
cjo01100  Metabolic pathways
Module
cjo_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107319894 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjo01002]
    107319894 (MGLL)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107319894 (MGLL)
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S33
   107319894 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Peptidase_S9 Lipase_3 Abhydrolase_2 PGAP1 Thioesterase Abhydrolase_5 LIP DUF1350 DUF2436 FSH1 DUF2048
Motif
Other DBs
NCBI-GeneID: 107319894
NCBI-ProteinID: XP_015730718
Position
12
AA seq 314 aa AA seqDB search
MSSKHKGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPAAAARALVFIAH
GAGEHCGRYDDLAQRLTELNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKK
DHPGLPILILGHSMGGAISILTASERPSDFSGMLLISPLVVASPEVATPIKVFAAKVLNL
VLPNLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAITRIERALPKLTL
PILVLHGSSDKLCDIKGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVTTSVFTEILTW
ISQKVSAAGETSQT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaaacacaaaggtcattcatccagaatgcccgaggaaagttcaccaaagcgg
agtcctcaaaacatcccatacaaggatctgccccacatcatcaacgctgatgggcagcac
ctcttctgcaggtactggaagccagcagcagctgccagggccctcgtgtttatcgctcat
ggcgctggggaacactgcggccgttatgatgacttggcccagaggctgacagaacttaac
ttgtttgtatttgcccatgaccatgttggtcatgggcagagtgagggagatcggatggtt
gtctcagatttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaag
gatcacccagggctgcccatcctcatcctgggtcactccatggggggagccatctccatc
ctgacagccagcgagagacccagtgacttttcaggcatgctgctaatctctcctctggtg
gttgccagcccagaagttgccacccccatcaaggtttttgcagctaaagtactcaacctt
gtgcttccaaacttgtctctgggatcaatagatccaaatgcaatttcccggaacaagaag
gagatggagtcctacacttctgacccactggtctaccatggtggcatgaaggtctccttt
gtcatccagctgatgaatgccattaccagaatcgaacgagctctgcccaagctgactttg
cccatcctggtgctgcacggctcttctgacaagctctgtgatatcaaaggctcctattta
ctgatggacacggtgcagagccaggacaaaacgctgaaggtgtatgaggaagcctaccat
gcactgcacaaagagctgcccgaggtcaccacctccgtcttcacagaaatactgacctgg
atcagccagaaggtttcagcagctggagaaaccagccagacctaa

DBGET integrated database retrieval system