KEGG   Coturnix japonica (Japanese quail): 107319958Help
Entry
107319958         CDS       T04297                                 

Gene name
SUCLG2
Definition
(RefSeq) succinate-CoA ligase GDP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00020  Citrate cycle (TCA cycle)
cjo00640  Propanoate metabolism
cjo01100  Metabolic pathways
cjo01200  Carbon metabolism
Module
cjo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107319958 (SUCLG2)
   00640 Propanoate metabolism
    107319958 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjo04147]
    107319958 (SUCLG2)
Enzymes [BR:cjo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107319958 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107319958 (SUCLG2)
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107319958 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 107319958
NCBI-ProteinID: XP_015730848
Position
12
AA seq 432 aa AA seqDB search
MAFPVTVRACAALRDLALRSARLRGSFPAVQLTPRRWLNLQEYQSKKLMADHGVTVQRFF
VADSADDALEAAQRLKAKEIVLKAQILAGGRGKGTFNSGLKGGVHLTKDPKTVEQLAKQM
IGYNLSTKQTPKDGVKVKKVMVAEALNISRETYFAILMDRACNGPVMVGSPQGGVDIEEV
AVTSPELIFKEEIDIFEGIQDHQALQMAKNLGFKGPLQQQAADQIKKLYNLFLKIDATQV
EVNPFGETPEGQVVCFDAKINFDDNAEFRQKEIFAMDDKSENEPIENEAAKYDLKYIGLD
GNIACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILV
NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQRILNESGLPITSARDLED
AAKKAVASVARK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcccgtgaccgtgcgggcgtgcgctgctctgcgggacctggccctgcgatcc
gcccgcctgcggggcagcttcccggctgttcaattaacccctagacgatggctgaatctg
caggagtaccaaagcaaaaagctgatggcagaccacggggttacagttcagagattcttt
gtggctgattctgctgatgatgccctggaggctgctcaaagactaaaggcaaaggaaatt
gttctgaaggcacagattctggctggagggagaggaaaaggtactttcaacagtggattg
aaaggaggagttcatctaactaaagaccctaagactgtcgaacagcttgctaaacagatg
attgggtacaatctgtcaacaaagcaaactccaaaggatggtgtgaaagtgaaaaaggtg
atggttgcagaagcactgaatatttcaagggaaacatactttgcaatcttgatggacaga
gcctgcaatggacctgtaatggttggcagtccacagggtggtgttgacatagaagaagtt
gcagttactagcccggaacttatatttaaggaagaaatagatatttttgaaggcatacaa
gatcatcaggcattgcagatggcaaaaaatttgggattcaaaggacctctgcaacagcag
gcagcagatcaaattaagaagctttataatcttttcttgaaaattgatgccactcaggtt
gaagtgaatccctttggtgaaactccagaagggcaagttgtttgctttgatgccaagata
aactttgatgacaatgcagaatttaggcaaaaagaaatatttgccatggatgacaagtct
gaaaatgagcccatagagaacgaagctgccaaatatgacttaaaatatataggactggat
ggaaatattgcttgcttcgtgaatggagctggtcttgcaatggcaacttgtgatattata
tctctgaatggaggaaaaccagccaacttcctggatctgggaggaggtgtgaaagaagca
caggtgtaccaagcattcaaactgctgactgccgatccaaaggttgaagcaatacttgta
aacattttcggtggtatcgtgaactgtgccattatagccaatggtattaccaaagcctgc
cgagagcttgagctgaaagtgcctctggtggtcaggctggaaggaacaaatgttcacgaa
gcccaacgcatcttgaatgaaagtggactccctattacctctgcaagagaccttgaagat
gcagcaaagaaggcagtggcaagtgtggctagaaagtaa

DBGET integrated database retrieval system