KEGG   Coturnix japonica (Japanese quail): 107320119Help
Entry
107320119         CDS       T04297                                 

Gene name
MRPL22
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107320119 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cjo03011]
    107320119 (MRPL22)
Ribosome [BR:cjo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107320119 (MRPL22)
  Bacteria
    107320119 (MRPL22)
  Archaea
    107320119 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 107320119
NCBI-ProteinID: XP_015731143
Position
13
AA seq 211 aa AA seqDB search
MAARCAGGAGGAWMRGILGWARPERWFAAGSVFPLSCIHTSTSLQKLGKWEKKNRIVYPP
QLPGEPRRPAEIYHCRREIKYSKDKMWYLAKLIKGMSIDQALAQLEFNDKKGAKVIKEVL
LEAQEMAVRNHNVEFKSNLHIAESLAGKGHYTKRIRIHGKGMFGIMKIVKCHYFVKLVEG
PPPLPEPRKTGYDQAKEYVQQLRSRTLVHTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggtgtgcgggaggtgctggtggagcctggatgcgggggattctcggctgg
gctcggccggagaggtggtttgcagctggaagtgttttcccgctctcatgtatccacaca
agtacatccctgcaaaaacttgggaagtgggagaaaaagaacaggattgtgtaccctcct
cagctgcctggagagcctcgaagaccagctgaaatatatcactgtcggagggaaataaaa
tacagcaaagataagatgtggtatctggcaaaactgattaaaggaatgtccattgatcaa
gctcttgctcagctggaatttaacgataaaaagggtgcaaaggtaatcaaagaggttctc
ttagaggctcaggaaatggcagtaaggaatcacaacgtggagttcaaatcaaatttacat
atagctgagtctctggcaggcaaaggccactatacaaaacggatccgtatccatgggaaa
ggcatgtttggcatcatgaaaatcgtcaagtgccactactttgtgaagctggtggaaggt
cctcctcctcttccagagccacgaaagactggttatgaccaagcaaaagaatatgtacaa
cagctgcgcagtagaacccttgttcatacactgtga

DBGET integrated database retrieval system