KEGG   Coturnix japonica (Japanese quail): 107320195Help
Entry
107320195         CDS       T04297                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00480  Glutathione metabolism
cjo00590  Arachidonic acid metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107320195 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107320195 (GPX3)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107320195 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 107320195
NCBI-ProteinID: XP_015731326
Position
13
AA seq 219 aa AA seqDB search
MGCRAACVLAVLLAGLVPLGQGQEREKVKCYDNVRGTIYDYGALTIDGDEYIPFRRYAGK
MVLFVNVATYUGLTLQYLELNALQNELGPYGLVVLGFPSNQFGKQEPGQNSEILPALKYV
RPGGGFVPNFQLFQKGDVNGAKEQKVYSFLKNSCPPVAEEFGNPKNLFWEPLRNHDIKWN
FEKFLVGTDGVPVMRWYHRANIATVKNDIIAYMRQQRRQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggggtgccgagccgcctgcgtgctggccgtgctgctggccgggctcgtcccgctgggg
cagggccaggagagggagaaggtgaaatgctacgacaacgtgcggggcaccatctacgac
tacggggcgctgaccatcgatggggacgagtacatccccttccgaaggtacgcggggaag
atggtgctcttcgtcaacgtggccacatactgagggctcaccctgcagtacctcgaactg
aatgcactacaaaatgagctggggccctatggacttgtcgtcctgggcttcccctccaac
caatttgggaagcaggagcctggccagaactctgagatcctccctgcgctgaagtacgtg
cggccaggaggtggcttcgtccccaacttccaactcttccagaaaggggatgtgaatggg
gccaaggagcagaaggtctacagcttcctgaagaattcctgccctccggtggcggaggag
tttggcaaccccaagaacctcttttgggagccactgaggaaccacgacatcaaatggaac
tttgagaagttcctggtgggcactgacggggtgcccgtcatgcgctggtaccaccgtgcc
aacatcgccaccgttaagaacgacatcattgcctacatgcggcagcagcggcgccagtag

DBGET integrated database retrieval system