KEGG   Coturnix japonica (Japanese quail): 107320245Help
Entry
107320245         CDS       T04297                                 

Gene name
RARS
Definition
(RefSeq) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107320245 (RARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjo01007]
    107320245 (RARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjo03016]
    107320245 (RARS)
   03029 Mitochondrial biogenesis [BR:cjo03029]
    107320245 (RARS)
Enzymes [BR:cjo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     107320245 (RARS)
Amino acid related enzymes [BR:cjo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   107320245 (RARS)
Transfer RNA biogenesis [BR:cjo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107320245 (RARS)
 Prokaryotic Type
   Other AARSs
    107320245 (RARS)
Mitochondrial biogenesis [BR:cjo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107320245 (RARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N Cnn_1N Nup54 tRNA-synt_1e tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 107320245
NCBI-ProteinID: XP_015731412
Position
13
AA seq 662 aa AA seqDB search
MMEARVAQAAARLERQENEIKSLTAEIEHLKNFGCLGVSPSLEGLRDENAKLKYRLSFLQ
KSLQEERNKTVKSMININSCLQEIFGAAIQAAYPELENPPLVVTPSQQPKFGDYQCNSAM
GITQILLKTREQKVSPREIAEKITKHIPANECIEKVEIAGPGFINVHLRKDFVSKQLSSL
LMNGVQPPAIGKRKRVILDFSSPNIAKEMHVGHLRSTIIGESMCRLFEFAGHDVLRLNHL
GDWGTQFGMLIAHLQDRFPDYLSVSPPIGDLQAFYKESKRRFDTEEEFKKRAYQCVVLLQ
SKDPDFIKAWQLICDVSRKEFQKIYNCLDITLTERGESFYQDMMKDIIKEFEDKGFVQVD
DGRKVVFVPGFSVPLTIMKSDGGYTYDTSDLAALRHRLLEEKGDILIYVVDSGQSVHLQT
IFAAGQMIGWYDPKVTRITHAAFGVVLGEDKKKFKTRSGDTVRLTDLLEEGLKRAMDKLK
DKERDKVLTPEELKAAQMSVAFGCIKYADLSHNRLNDYVFSFDKMLDDRGNTAAYLLYAF
TRIRAIARLANIDEKMLRKAAREEVLVLDHEKEWKLGKCILRFPEILQKILDDLLLHTLC
DYLYELATTFTEFYDNCYCVEKDRQSGQIVKVNMWRLLLCEATATVMAKGFDILGIKPVE
RM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggcccgcgtggcgcaggcggcggcccggctggagcggcaggaaaacgagatt
aagtcactgactgcggaaattgagcatctgaagaacttcgggtgcctgggagtctccccg
agtttggaagggctgcgagacgaaaacgcaaagctgaagtatcggttgagtttccttcag
aagagccttcaagaggaacgaaataaaacagtgaaaagcatgattaatatcaacagctgt
cttcaggagatctttggagctgccattcaggctgcttacccagagctggaaaaccctcca
ctggtggtgacaccaagtcagcagcccaagtttggggattatcagtgcaacagcgccatg
ggcataacacagatactgctgaaaaccagggaacagaaggttagtccgagggagatcgct
gagaaaataacaaaacatattcctgcgaacgaatgcattgagaaggtggaaattgctggt
cccggttttatcaacgtccatctgcggaaggattttgtatcaaagcagctgagcagttta
ttaatgaatggagttcaaccaccagctattggcaaaaggaaaagggtgatactggatttc
tcctcccctaacattgcaaaggagatgcatgttggtcacctgcggtccaccatcatcgga
gaaagtatgtgccgcctcttcgagtttgcaggtcatgatgtgctgaggttaaaccattta
ggagactggggcacccagtttggaatgctcattgctcacctgcaagacagatttccagat
tacttatctgtttctcctcccattggggatctccaagctttttacaaggaatccaagagg
agatttgacacagaggaggaatttaagaagcgagcgtaccagtgtgtggtgctgctgcag
agcaaagacccggacttcattaaagcctggcagctgatctgcgacgtgtcgcggaaagag
ttccagaaaatctacaactgcctggatatcacacttacagagagaggggagtcgttctac
caagatatgatgaaagacatcatcaaagaatttgaagataaaggctttgtccaggtggat
gatggccggaaggttgtctttgtcccaggtttctctgtcccgctgactatcatgaagtca
gatggaggttacacatatgacacgtctgacttggctgcacttagacacaggctgcttgaa
gagaagggtgatatcctgatctatgttgtcgacagtggccagtcggtgcatttgcaaaca
atatttgcagctggacagatgatcggctggtatgaccccaaagtaaccagaatcacccac
gctgcattcggagtggtgctgggagaagacaagaagaagttcaaaacgcgctcaggggac
acagtgcgtcttacagatcttctggaagaagggctgaaacgagccatggacaaactgaaa
gacaaggagcgggacaaggtcctcacaccagaagagctgaaagctgcccagatgtcagtc
gcttttggatgcattaaatacgcagatctctcccacaacagactaaatgactacgtgttc
tcctttgacaagatgctggatgacagaggaaatacagctgcttatttgctgtatgcgttc
acacggatcagggctattgcacgcctggccaatattgatgagaagatgctgcggaaagca
gccagggaggaggtgcttgtccttgaccatgagaaagagtggaaactgggcaagtgcatc
ctgaggttccctgagattctgcagaagatcctggacgatctgttactgcatacgctgtgt
gactacctctatgagctggccaccaccttcactgagttctacgacaactgttactgtgtg
gagaaggacaggcagagtggccagattgtgaaggtgaacatgtggagactgctgctgtgc
gaggccactgccactgtcatggccaaaggttttgacatcctgggaattaagcctgtggag
aggatgtaa

DBGET integrated database retrieval system