KEGG   Coturnix japonica (Japanese quail): 107320351Help
Entry
107320351         CDS       T04297                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04020  Calcium signaling pathway
cjo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107320351 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107320351 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjo04030]
    107320351 (HTR4)
G protein-coupled receptors [BR:cjo04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107320351 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 107320351
NCBI-ProteinID: XP_015731582
Position
13
AA seq 386 aa AA seqDB search
MEELDVNVSSSEGFSVAEKIVLLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRIAVMLGGCWVIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASN
STYCIFMVNKPYAITCSVVAFYFPFLLMVLAYYRIYVTAREHARQIRVLQRAGTPADSRH
QPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFINYTVPGKLWTAFLWLG
YINSGLNPFLYAFLNKPFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRYA
VLHNGHHQEHQKLPIHNDPESQESCF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcttgatgttaatgtgagttcgagtgagggcttcagtgtagcagagaagatc
gtactgctcaccttcatctctgcggttatcctgatggccatcctggggaacctgttggtg
atggtggctgtgtgccgggacaggcagctcaggaaaatcaagaccaattatttcattgtt
tctcttgcctttgcggacctgctggtgtcagtactggtgatgccatttggagccattgag
ttggtccaggacaactggatctatggggagatgttctgccttgtccgaacatcccttgac
gtcttgctcaccacagcatcgatcctgcacctgtgctgcatatcactggacaggtactat
gctatttgttgccagccactggtgtacaggaacaagatgactccactgcgtattgctgta
atgcttggaggctgctgggtaatcccgacatttatttctttcctccctatcatgcaaggc
tggaatagcattggcatcattgatttgattcaacaaaggcagttcaacaaggcttccaac
tccacatactgcatattcatggtcaacaagccatatgccattacctgctctgtggtggcc
ttctactttcctttcctgctgatggtgctggcctactatcgcatctatgtcaccgcccgg
gagcacgcccggcagatccgggtgctgcagcgtgcagggacccctgctgacagccggcac
cagcctgaccagcacagcacgcatcgcatgaagaccgagaccaaagctgccaagaccctg
tgcatcatcatgggttgcttctgcctgtgctgggcccccttctttgtcacaaacattgtg
gaccctttcataaactatacggtgcctgggaagttgtggacagctttcctgtggctgggc
tacatcaattcagggttgaaccccttcctctatgccttcctgaacaagcctttcagacgt
gccttcctcatcatcctgtgctgtggtgatgagcgataccgaaggccttccatcctgggg
cagacagtcccctgttccaccaccacaataaatggatcaactcatgtgctaaggtatgct
gttttacacaatgggcatcatcaggaacaccagaagcttcccatccacaatgacccagaa
tcccaggagtcctgtttctag

DBGET integrated database retrieval system