KEGG   Coturnix japonica (Japanese quail): 107320780Help
Entry
107320780         CDS       T04297                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04260  Cardiac muscle contraction
cjo04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107320780 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107320780 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    107320780 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjo04040]
    107320780 (CACNG3)
Ion channels [BR:cjo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107320780 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107320780
NCBI-ProteinID: XP_015732479
Position
14
AA seq 315 aa AA seqDB search
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSGGDNDTSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFY
FGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKRSAFTRLPPYRYRFRRRSSSRST
EPRSRDMSPISKGFGTIPSTDISMFTLSRDPSKVTMGTLLNSERDHGFLQVHNSIPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggcgtccagatgctcatcaccacggtgggagccttcgcagcc
ttcagcctgatgaccatcgccgtgggcaccgactactggctctactcgcgcggcgtgtgc
aggactaagtccggcggcgacaacgacacgagccgcaagaacgaggaggtgatgacccac
tcggggctctggaggacgtgctgcctggaaggaaccttccgaggagtctgcaagaagatc
gaccactttcctgaggatgcagactacgagcaggacacagctgaatacctcctccgtgct
gtcagagcctccagcatcttccccatcctgagcgtgggcctgctcttctttggggggctg
tgtgtggcagccagcgagttctacaagagcaaacacaacgtcatcctcagcgccggcatc
ttctttgtctcagcaggtctcagcaacatcattgggatcatcgtctacatctcagccaac
gcgggggacccggggcagagcgactccaagaagagctactcctacggctggtccttctac
ttcggtgcactgtccttcatcatcgccgagatggtgggggtgatcgccgtgcacatgtac
atcgagaagcaccgccagatccgcgccaggtcccactcggagctgctgaaacggtcggca
ttcacccgcctgcccccctaccggtaccgcttccgccggcggtccagctcgcgctccact
gagccacgttcccgggacatgtcgcccatcagcaagggctttggcaccatcccctccacc
gacatctccatgttcaccctctccagggatccttccaaggtcaccatggggacgctgctc
aactcggagcgggaccacggttttttacaggtccacaactccatccccaaagagttcaag
gagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system