KEGG   Coturnix japonica (Japanese quail): 107321734Help
Entry
107321734         CDS       T04297                                 

Gene name
ZDHHC12
Definition
(RefSeq) zinc finger DHHC-type containing 12
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107321734 (ZDHHC12)
Enzymes [BR:cjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     107321734 (ZDHHC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF4501 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 107321734
NCBI-ProteinID: XP_015734415
Position
17
AA seq 261 aa AA seqDB search
MGAGGMWVRTAHTALSGVLTLGLFLHRTDLQKEAERGAVLQPTLFVALLGCSVLLYFKVS
LMDPGFVRAEEEAKAEKSEEQRTMIPQVSSSVKMRRCGYCMVKQPMRAKHCQLCQHCVRR
YDHHCPWIENCVGEKNHPLFIVYLSVQLIVLLWGGHVAWSGLYFKQSWEWLWHNIFLLVS
FLLIVVFTIVVLLLLISHLYLISCNTTTWEFMSYHRISYLRHSELENPFDQGVIRNLWRF
FCSCHLTAWEKIYFHRNNETV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggagccggcgggatgtgggtgagaaccgcacacaccgccctcagcggggtcttaacg
ctggggctgttcctgcaccgcacagacctacagaaggaagcggagcgcggagccgtgctg
cagccaacgctgttcgtggcgctgctcgggtgctccgtcctgctgtatttcaaggtgtcc
ctcatggacccgggcttcgttagggctgaagaggaagcaaaggcagagaaaagtgaagaa
caacgcacgatgataccccaggtttcaagcagtgttaagatgcggcgttgtggctactgc
atggtgaagcaaccaatgagagccaagcactgccagctgtgccaacattgtgttcggcgc
tatgaccatcactgcccctggattgagaattgtgtaggagagaagaatcaccctctcttc
atagtctaccttagtgtacagctcatagttctgctgtggggaggacacgttgcttggtca
ggcctttactttaaacagtcctgggagtggctgtggcacaacattttcctcctcgtatcc
ttcctcctgatagttgtattcaccattgttgtcttgctgctgcttatttcacacctctat
ctgatctcatgcaacaccaccacctgggagttcatgtcataccaccgcatctcctacctg
cgacactcagagctggagaatccctttgaccaaggagtaatccgcaatctctggaggttt
ttctgttcgtgccatctcactgcatgggagaaaatctattttcacaggaacaatgaaact
gtctag

DBGET integrated database retrieval system