KEGG   Coturnix japonica (Japanese quail): 107321769
Entry
107321769         CDS       T04297                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjo01002]
    107321769 (ADAMTS13)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107321769 (ADAMTS13)
Peptidases and inhibitors [BR:cjo01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107321769 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin ADAM_spacer1 Reprolysin_4 Pep_M12B_propep Reprolysin_5 Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10 Peptidase_M66 cwf21
Other DBs
NCBI-GeneID: 107321769
NCBI-ProteinID: XP_015734539
Position
17
AA seq 1256 aa
MIISLTIRVLIMFPLGFCWPSILQERFLRALDADDVFSYFGTSSASDVPEFVVAQPDCPC
KEEQTGLMCQIQHCSIKAWGEVFTFEFLEDHTLLSSSFVISQVVNSSFSLIKRFSGNCFA
GGNLLAPPGAECRVTYCEGQLQGVIVTDEEKIHIRPVRRKDTALLKDLGFSRPHILFRQA
AIGAKKARGHFASRLQKRADGTVKHLELMVVAGPDVYMYHQEDTERYILANLNIGAELLR
DASLGAHLRVHLMQMLVLKEPEINVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVL
YVTRFDLELPDGNKELRGVTQLGGVCSSSWSCVITQDTGFDLGVTIAHEIGHSLGIPHDG
EGNQCSSRGYIMGSAGNHNSVDLIWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGWKP
GLYYGADEQCKIAFGSVATACTFADSNVDICKVLSCHVQPGDKTSCTRLLVPLLDGTECG
INKWCFKGQCSSLKELNPMAVVHGQWSSWSPLSSCSRSCGGGVQIRQRFCNNPRPAFGGK
ECQGASIQAEMCNTQACLMTQLDFMAEQCAATNLKPLYLTVGVPSFYNWTSAVGFAKGDM
QCKHMCRAIAEEFMVSREDSFRDGTRCEPDNSEDGTFHLCVAGSCRAFGCDGQMGSKKAM
DSCKVCGGDNTTCMEVSGSYTEGKAKEYVTFLSLPYNATSVHVINQRPLFTHLAVKVKGE
YVVAGRGKNSLNVTYPSVLEDRQIEYKVFLTKDNLPSLEEIHVDGPTQEEIEIQVYRRYA
KEYGDATNPDITFSYFVPKENLTYRWIPQQGPCSVTCGGGTRRVNHVCFDQKKNEITENR
LCLELLQPLPGFEPCAMEPCPYRWKVSQTDECSAVCGSGVAQQNLTCVLFHNELETVVDD
SLCSAQEKPLTTVPCIVNVCPLGWDKEDTGLLQTPESPGHIQLENQSVYVWSPLAGECSV
SCGTGKTQIQYVCVAFDTKEKTQEENCHPVAKPESRLEDCNLSPCPPRWHYKMGSCSVSC
GGGVMQKILYCARETREKEEEIVADTQCDGLPRPEEQEMCNLEPCPPRWKVTPGGPCSSS
CGLGLSVQLVTCVQIQQGKEVLLEQHSCPVSEKPLTTIPCVTRMCSYEWSFSEWTECSAS
CGNGVQTRHDFCLNRLTHKHVNPIFCRRFPKAIVLRGCSAGPCPEQGVGTNLHGAELQAV
TPAMHLMTTANAEVARYKGLILPSSALPAVPQEQMKEISEGEEQTTHKVQMGTNCV
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgatcatcagtctgaccatccgagtactcataatgttccctctggggttttgctggccc
tccatcctccaagagaggtttctcagagctttggatgcagacgatgttttctcttatttt
ggaaccagctcagcgtctgatgtacctgagtttgttgttgctcagccagattgcccttgt
aaagaagagcagactgggctgatgtgtcagatccagcactgctccattaaggcttgggga
gaagtgttcaccttcgaatttctagaggaccataccctcctttcctcttcctttgtgatc
agccaagtggtgaactcttcctttagcttaataaagcgattctcaggcaactgctttgca
ggtggaaatctgttggcacctcctggggctgagtgtagagtcacttactgtgaagggcag
ctgcaaggagtcattgttacagatgaagaaaagattcacatcaggcctgtcagaagaaaa
gatacggccctgctgaaggatcttggcttctccagaccccacattctcttcagacaagct
gcaataggggcaaaaaaagcaagagggcactttgcttctcgcctacaaaagagggctgat
ggaactgtcaaacatctggagctgatggttgtagcaggtcctgatgtttacatgtaccac
caagaggacacagagcgatatattcttgccaacctgaacattggggcagaactgctgcga
gatgcctcactgggtgctcatttaagggttcatttgatgcaaatgctcgttttgaaggag
ccggagattaatgtgaatatcacaacaaacatcacctcctcgctgatcagtgtttgtgag
tggagcaagaaggtcaacccccagaatgactctgatccccagcatgccgacatcgtcctg
tatgtgaccaggtttgatctggagttacctgatgggaacaaggagctacgtggagtgact
cagttaggtggggtctgctcctcctcctggagctgtgttattacccaggacactggcttt
gacttgggagtcaccatagcccacgagattgggcacagtcttggcatcccccatgatggt
gaagggaatcagtgcagcagcagaggttacatcatgggttcagcaggaaaccacaacagt
gttgacctcatctggtcacagtgtagccgagaagaattcctggcctttgtcagcacaggc
caaacaaactgcttaaatgacctgccggacatggacggcagcatccctggatggaagcct
ggcttgtactatggagcagatgagcaatgtaaaatagcctttgggagtgttgcaaccgcg
tgcaccttcgctgacagcaatgttgatatatgtaaggttctctcatgccatgtacaacca
ggagacaaaaccagctgtactcggcttcttgttcccctcttggacggtactgagtgtggc
atcaataagtggtgcttcaagggacagtgcagctctctgaaagaactaaaccccatggct
gtagtccatggccagtggtccagctggagcccattgtcctcctgctcccgcagctgtgga
ggtggagttcagataaggcagcggttctgtaataaccccaggcctgcttttggagggaag
gagtgccagggtgccagcattcaagcagagatgtgcaatactcaggcctgtctgatgacc
cagcttgactttatggctgaacagtgtgcagcaacaaatttaaagccactgtatctcact
gtaggagtgccatccttttacaactggacttctgctgttggctttgccaaaggggacatg
cagtgcaagcacatgtgcagggccattgcagaggaattcatggtaagccgtgaggacagt
ttcagagatggaaccagatgtgagcctgataactctgaagatgggactttccatctgtgt
gtagcaggaagctgcagagcattcgggtgtgatggtcagatgggctccaagaaggcaatg
gactcttgcaaggtctgtgggggtgataataccacctgcatggaagtgagtggatcttac
acagaaggaaaagctaaagagtatgttacatttttgtccctgccttataatgccacctca
gtccatgttatcaatcagagaccgctcttcacacacttggctgtgaaggttaaaggtgaa
tatgtggttgctggaaggggaaaaaactcattgaatgtcacctatccctcagttctggag
gacagacagattgaatacaaagtgtttctcaccaaggacaacctgccaagcctggaggaa
atccatgtggatgggccaacccaagaagaaattgaaatacaggtttatagacggtatgca
aaagaatatggcgatgccaccaacccagacatcaccttcagctactttgtgccaaaagag
aatctgacgtataggtggattcctcagcagggaccatgttcagtgacctgtggaggaggt
acacgacgggtgaaccacgtgtgctttgatcagaagaagaatgaaataacagaaaatcgg
ttgtgtttggaactcctacaaccccttccagggttcgaaccctgtgccatggaaccatgc
ccgtacaggtggaaggtatctcagacggatgaatgttctgctgtctgtggaagtggtgtt
gcccagcagaatttgacctgtgttctgtttcataatgaattggagactgttgtggatgac
agcttatgttctgcacaagaaaaaccactcaccactgtgccgtgtatagttaatgtctgc
cctttgggatgggacaaagaagacacaggcttgcttcagactccagagtcacctggccat
atccaactggaaaatcagagtgtttatgtctggagccctctagctggagagtgttcagtg
tcctgtggtacaggtaagactcagatacagtacgtatgtgtggcttttgacaccaaagaa
aaaacccaagaagaaaactgtcatccagtggcaaagccggagagcaggttggaagactgc
aatcttagtccctgcccaccaaggtggcattacaaaatgggctcatgcagtgtaagctgt
ggaggaggtgtgatgcagaagatcctatactgtgcaagggaaaccagagagaaggaagaa
gagattgttgcggacacccagtgtgatggtttgcctcgtccagaggagcaggagatgtgt
aacttggagccgtgccccccaagatggaaggtaaccccaggtggcccctgttcctccagc
tgtgggcttggcttatctgttcagctggtcacttgtgtgcagattcagcaaggcaaagag
gttttgctggagcaacattcatgtcctgtgtcagagaagccccttaccaccattccctgt
gtcacccgaatgtgttcttatgaatggagcttcagtgaatggacggagtgttcagcctca
tgtgggaatggtgttcagacacggcacgatttctgcctcaaccgactgactcataagcac
gtgaaccccatcttctgcaggcgcttccccaaggccattgtgctgcgtggctgctctgca
gggccctgtcctgagcagggggtgggcacaaatctgcatggagcagaactgcaggcagtg
acaccagccatgcatctgatgactactgcaaatgctgaagtggcaagatacaaaggcctg
attcttccttcatctgctctgccagctgtccctcaggaacagatgaaggagatcagtgaa
ggtgaggagcaaactacccataaggtacagatgggcactaactgtgtgtga

DBGET integrated database retrieval system