KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_03455Help
Entry
A911_03455        CDS       T02264                                 

Definition
(GenBank) putative ribosomal pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Brite
KEGG Orthology (KO) [BR:cjp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cjp03009]
    A911_03455
Enzymes [BR:cjp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A911_03455
Ribosome biogenesis [BR:cjp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A911_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFU42796
Position
666587..667339
Genome map
AA seq 250 aa AA seqDB search
MQEKAYKLLALQEKISNREAKDLIDKGCVFSYGKKVVVARALMSDKARFNVIKAKNPQII
FEDDKIIAINKPYAYVSEDLEKKFNAKLLNRLDKETSGVILLCKDEDFRKLCIEEFKKHR
VYKSYIAVLDGVLAEEVEVNEPIFTIKVKGGALSKVSKDGLSALSIITPIMMQSKKTLAK
IVIQTGRTHQIRVHAKFIKHGVVGDEKYAKISSDRMYLHSYEIKIFNYHFRANLDSGFAK
FGFDIKNLDF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaagcttataaactcttagctttgcaagaaaaaatttcaaatcgtgaagct
aaagatttgattgataagggttgtgttttttcatatggaaaaaaagttgtggttgctaga
gctttgatgagcgataaggcaagatttaatgtgataaaagctaaaaatcctcaaattatt
tttgaagatgataagattattgctattaataaaccttatgcttatgtgagtgaagattta
gagaaaaaatttaatgccaagcttttaaatcgtttagacaaagaaacaagtggtgtgatt
ttgctttgtaaagatgaagattttagaaagctttgtatagaagaatttaaaaaacacagg
gtttataaaagttatattgcggttttagatggggttttggctgaagaggttgaagtgaat
gaacctatttttactataaaagtaaaaggcggggcgttaagtaaagtttcaaaagatggt
ttaagtgccttaagtatcattactcctatcatgatgcagtcaaaaaaaaccttagcaaaa
atagttattcaaacaggtagaactcatcaaatcagagtgcatgctaaatttataaaacat
ggcgttgtaggtgatgaaaaatatgctaaaatttcaagcgatagaatgtatttgcatagc
tatgaaattaaaatttttaattatcattttagggctaatttagatagtggttttgcaaaa
tttggctttgatataaaaaatttagatttttaa

DBGET integrated database retrieval system