KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_03915Help
Entry
A911_03915        CDS       T02264                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cjp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    A911_03915
Enzymes [BR:cjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     A911_03915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFU42883
Position
761237..762016
Genome map
AA seq 259 aa AA seqDB search
MNTEFQGKTLVISGGTRGIGKAIVYEFAKVGANIAFTYNSNAQIADEMVQDLEKNYKIKA
RAYEFNILEPETYKELFEKIDVDFDRVDYFISNAIISGRAVVGGYTKFMKLKPKGINNIF
TATVNAFVVGAQEAAKRMEKVGGGSIISISSTGNLVYIENYSGHGTAKAAVEAMVRYAAT
ELGEKNIRVNVVSGGPIETDALRAFTNYEEVKQATINLSPLNRMGQPEDLAGACLFLCSS
KASWVTGHTFIVDGGTTFK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaatttcaaggaaaaactttagtgattagcggtggaactcgcgggataggc
aaagctatagtttatgaatttgctaaagtgggtgcaaatatagcttttacttataattct
aatgcgcaaattgctgatgaaatggttcaagatttggagaaaaattataaaatcaaagct
agagcttatgaatttaatatcttagaacctgaaacctataaagaactttttgaaaaaatt
gatgtggattttgatagagtggattattttatctcaaatgctatcatttcaggacgtgcg
gttgtaggtggctataccaaatttatgaagttaaaaccaaagggaattaataacattttt
acagccacagtaaatgcttttgttgtgggcgcacaagaagcagctaaaaggatggaaaaa
gtagggggtggaagcattatttctatctcatctacaggaaatttagtgtatatagaaaat
tattcaggtcacggtacagcaaaagccgctgtagaagctatggtaagatatgcggctact
gaacttggagaaaaaaatatccgtgtaaatgtcgtaagtggtgggcctattgaaactgat
gctttaagagcttttacaaattatgaagaagtaaaacaggctactataaatttaagccct
ttaaatcgcatggggcagcctgaagatttggctggagcatgtctttttctttgttcaagt
aaggcaagttgggttacaggacatactttcatcgttgatggtggtacaacttttaaataa

DBGET integrated database retrieval system