KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_08200Help
Entry
A911_08200        CDS       T02264                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cjp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A911_08200 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cjp03011]
    A911_08200 (rplV)
Ribosome [BR:cjp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A911_08200 (rplV)
  Bacteria
    A911_08200 (rplV)
  Archaea
    A911_08200 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFU43700
Position
complement(1611817..1612242)
Genome map
AA seq 141 aa AA seqDB search
MSKALIKFIRLSPTKARLIAREVQGMNAELAMASLKFMPNKGAKYIANAISSAVANGGFE
ANEVIVKSCRVDAAAVLKRFRPRARGSASRIRKPTSHILVEVAKAEVKSEEKKTVAKKTT
TTKAPAKKTTSTKKATVKKES
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcattaattaaattcataagattatctccaactaaagcaagattgattgct
agagaagttcaggggatgaatgcagaattagctatggctagtttaaaatttatgccaaat
aaaggtgcaaaatacattgcaaacgcaatttcaagcgcagtagcaaatggtggctttgaa
gcaaacgaagtgattgtaaaaagttgtcgtgttgacgcagctgcggtattaaaaagattt
agaccaagagctagaggaagtgcaagtcgtattagaaaaccaacttcacatattttagta
gaagtggcaaaagcggaagtgaaatctgaagagaaaaaaacagtagctaaaaaaactact
acaacaaaagctccagctaaaaaaacaacaagcactaaaaaagcaacagtgaaaaaggaa
agctaa

DBGET integrated database retrieval system