KEGG   Campylobacter jejuni RM1221: CJE0808Help
Entry
CJE0808           CDS       T00227                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cjr  Campylobacter jejuni RM1221
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cjr03009]
    CJE0808
Enzymes [BR:cjr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CJE0808
Ribosome biogenesis [BR:cjr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CJE0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AAW34593
Position
743706..744458
Genome map
AA seq 250 aa AA seqDB search
MQEKAYKLLALQEKISNREAKDLIDKGCVFSHGKKVVVARALMSDKARFNVIKAKNPQII
FEDDKIIAINKPYAYVSEDLEKKFNAKLLNRLDKETSGVILLCKDEDFRKLCIEEFKKHR
VYKSYIAVLDGVLAEEVEVNEPIFTIKAKGGALSKVSKDGLSALSIITPIMMQSKKTLAK
IVIQTGRTHQIRVHAKFIKHGVVGDEKYAKISSDRMYLHSYEIKIFDYYFKAELDNSFAK
VGFEIKNLDF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaagcttataaactcttagctttgcaagaaaaaatttcaaatcgtgaagct
aaagatttgattgataagggttgtgttttttcacatggaaaaaaagttgtggttgctaga
gctttgatgagcgataaggcaagatttaatgtgataaaagctaaaaatcctcaaattatt
tttgaagatgataagattattgctattaataaaccttatgcttatgtgagtgaagacttg
gagaaaaaatttaatgccaagcttttaaatcgtttagacaaagaaacaagcggtgtgatt
ttgctttgtaaagatgaagattttagaaagctttgtatagaagaatttaaaaaacacagg
gtttataaaagttatattgcggttttagatggggttttggctgaagaggttgaagtgaat
gagcctatttttaccataaaagcaaaaggtggggcattaagtaaagtttcaaaagatggt
ttaagtgccttaagtatcattactcctatcatgatgcagtcaaaaaaaaccttagcaaaa
atagtcattcaaacaggtagaactcatcaaatcagagtgcatgctaaatttataaaacat
ggcgttgtaggtgatgaaaaatatgctaaaatttcaagcgatagaatgtatttacatagt
tatgaaattaaaatttttgattattattttaaggctgagctagataatagttttgcaaaa
gttggctttgagataaaaaatttagatttttaa

DBGET integrated database retrieval system