KEGG   Campylobacter jejuni RM1221: CJE0945Help
Entry
CJE0945           CDS       T00227                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00520  Amino sugar and nucleotide sugar metabolism
cjr00550  Peptidoglycan biosynthesis
cjr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CJE0945 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CJE0945 (murA)
Enzymes [BR:cjr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CJE0945 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:cjr01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   CJE0945 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase COR
Motif
Other DBs
NCBI-ProteinID: AAW35282
UniProt: Q5HUT8
Structure
PDB: 

Position
complement(882041..883297)
Genome map
AA seq 418 aa AA seqDB search
MTYLEIEGTNHLSGNVTISGAKNAALPLIVSSILAKNEVKINNVPNVADIKTLISLLENL
GAKVNFQNNSALLNTNTLNQTIAKYDIVRKMRASILTLGPLLARFGHCEVSLPGGCAIGQ
RPIDLHLLALEKMGANIQIKQGYVVASGNLKGNEILFDKITVTGSENIIMAAALAKGKTK
LLNVAKEPEVVQLCEVLKDAGLEIKGIGTDELEIYGSDGELLEFKEFSVIPDRIEAGTYL
CAGAITNSKITLDKVNATHLSAVLAKLHQMGFETLIAEDSITLLPAKEIKPVEIMTSEYP
GFPTDMQAQFMALALKANGTSIIDERLFENRFMHVSELLRMGADIKLNGHIATIVGGKEL
NAADVMATDLRASSALILAALAAKGTSKVHRIYHLDRGYENLEEKFKGLGVKITRLEE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacttatctagaaatcgaaggcacaaatcatctaagcggaaatgttacaataagcggg
gcaaaaaatgctgccctacccttgatcgtttcaagcatacttgccaaaaatgaagtaaaa
atcaacaatgttcctaatgtggctgatataaaaactcttatatctttgctagaaaattta
ggagctaaagtcaattttcaaaacaatagtgctttattaaacacaaacactcttaatcaa
accatagctaaatatgacattgtgcgtaaaatgcgtgcttccatacttactctaggacct
ttacttgctcgttttgggcattgtgaagtatctttgcctggtggatgtgccataggacaa
agacctattgatttacatcttttagccttggaaaaaatgggggcaaatatacaaattaaa
caaggctatgtcgtagctagtggaaatttaaaaggcaatgaaattctttttgataaaatc
acggttacaggtagcgaaaacatcatcatggcagcagctttagctaaaggtaaaaccaag
ctcttaaatgttgcaaaagaacccgaagtagttcaactttgcgaagttttaaaagacgca
ggacttgaaattaaaggcataggtacagatgaacttgaaatttatggtagcgatggagaa
cttttagaatttaaagaatttagcgttatacctgatagaattgaggcaggaacttatctt
tgtgcaggggctattacaaattctaaaattactttagataaagttaacgccactcatctt
agtgcagttttagcaaaacttcatcaaatgggttttgaaactttgattgcagaagatagt
atcaccctacttcctgctaaagaaattaaacctgtagaaatcatgacaagtgaatatcca
ggctttccaaccgatatgcaagcgcagtttatggcactagctttaaaggctaatggaact
agcattatcgatgaaagactatttgaaaatcgcttcatgcatgtaagcgaactcttaaga
atgggtgcagatattaaactcaacggtcatattgctactatagtaggcggaaaagaactt
aacgctgctgatgtcatggctacagatttgcgtgcttcttcagcccttatcttagcagct
cttgcagctaaaggcacaagcaaagtccatagaatttatcatcttgatagaggttatgaa
aatttagaagaaaaatttaaaggtttaggtgttaaaatcacaaggcttgaagaatga

DBGET integrated database retrieval system