KEGG   Campylobacter jejuni RM1221: CJE1074Help
Entry
CJE1074           CDS       T00227                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00220  Arginine biosynthesis
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01130  Biosynthesis of antibiotics
cjr01230  Biosynthesis of amino acids
Module
cjr_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CJE1074 (argF)
Enzymes [BR:cjr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CJE1074 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AAW35402
UniProt: Q5HUG8
Structure
PDB: 

Position
complement(1002740..1003660)
Genome map
AA seq 306 aa AA seqDB search
MKHFLTLRDFSKEEILSLVNHASELKKEPKKLLQDKTLAMIFEKNSTRTRMAFELAITEL
GGKALFLSSNDLQLSRGEPVKDTARVIGAMVDFVMMRVNKHETLLEFARYSKAPVINALS
ELYHPTQVLGDLLTIKEWNKMQNGIAKVAFIGDSNNMCNSWLIAAAILGFEFSIAIPKNY
KISPEIWEFAMKQALISGAKISLSHDRFEALKDKDVVITDTWVSMGEENEKERKIKEFEG
FMIDEKAMSVANKDAILLHCLPAYRGYEVSEEIFEKHADVIFEEARNRLYVVKALLCFLD
NQRGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttttaactttaagagatttttctaaggaggaaattttaagccttgtaaat
catgctagcgagcttaaaaaagagcctaaaaaacttttacaagataaaactttagcaatg
atttttgagaaaaactctacaagaacaagaatggcctttgaattagccataacagagctt
ggcggaaaggctttatttttaagcagcaatgatttacaacttagtcgtggcgagcctgta
aaggatacagctagggtgataggggcgatggttgattttgtgatgatgagagtcaataaa
catgaaactttactcgaatttgcaagatattctaaagcccctgtgatcaatgctttaagc
gagctttatcaccctactcaggttttaggagatttgcttactatcaaagaatggaataag
atgcaaaatggtatagcaaaagttgcttttatcggagatagtaacaatatgtgcaattct
tggcttattgcggctgcgattttgggttttgaatttagtatagctataccaaaaaactat
aaaattagccctgaaatttgggaatttgctatgaaacaggctttgatttcaggagctaaa
atttccttaagtcatgatagatttgaagccttaaaggataaagatgtagtcattaccgat
acttgggtttctatgggtgaagagaatgaaaaagaacgcaagattaaagaatttgaagga
tttatgattgatgaaaaggctatgagcgttgccaataaagacgcgatattgcttcattgt
ttgcctgcttataggggttatgaagtgagtgaagaaatttttgaaaaacatgcagatgtg
atttttgaagaagcaagaaatcgcctttatgtggtaaaagccttgctttgctttttggat
aatcagagaggaagagaatga

DBGET integrated database retrieval system