KEGG   Campylobacter jejuni RM1221: CJE1287Help
Entry
CJE1287           CDS       T00227                                 

Gene name
waaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00540  Lipopolysaccharide biosynthesis
cjr01100  Metabolic pathways
Module
cjr_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CJE1287 (waaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cjr01005]
    CJE1287 (waaD)
Enzymes [BR:cjr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CJE1287 (waaD)
Lipopolysaccharide biosynthesis proteins [BR:cjr01005]
 Unusual sugar
  CJE1287 (waaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Ldh_1_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AAW35609
Position
complement(1204539..1205492)
Genome map
AA seq 317 aa AA seqDB search
MRVAITGGAGFIGSQLALNLQEKHEILIIDKMRSSATFENGNLQSFGHFKNLLEFDGELF
AGDINDEKVLKKIEDFKPEIIFHQAAISDTTVFDQTKVLQTNLNTFKDFIELSIDLNAKL
IYASSASVYGDAKSPQTVGKDEEPKNPYAFSKLMMDKLAKKYYDKAHLVGLRYFNVYGKG
EFYKNKTASMVLQFGHQILAGKNPRLFEGSDQIYRDFTYIKDVINANLIALDSKCGVYNV
GSGKARTFQDIVDILQKELKTDLPCEYIPNPYVKSYQFHTEAKLDQTWDYQPKFSLEEGI
KDYLDEIKRLFEKEVNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagtagcaatcacaggtggtgcaggatttataggttcgcaactggctttaaatttg
caagaaaaacatgaaattttaatcattgataaaatgcgtagcagtgcgacttttgaaaat
ggaaatttacaaagttttggacattttaaaaatttacttgaatttgatggagaacttttt
gcaggtgatattaacgatgaaaaagttttaaaaaagattgaagattttaagccagagatt
atttttcatcaagcagcaatttcagacactacagtttttgatcaaactaaggttttacaa
accaatttaaatacttttaaagattttatagaacttagcatagatcttaatgcaaagctt
atttatgcaagttcagcttcggtttatggtgatgcaaaaagtccacaaactgtaggtaaa
gatgaagagccaaaaaatccttatgctttttcaaaattgatgatggataagttagcgaaa
aaatattacgataaagctcatttggtaggacttagatattttaatgtttatggaaaaggc
gaattttataaaaacaaaaccgcttctatggttttgcaatttggccatcaaattttagca
ggaaaaaatccacgattgtttgaaggaagtgatcaaatttatagagattttacttatatt
aaagatgttattaatgccaatttaatcgcccttgattcaaaatgcggggtttataatgta
ggcagtggtaaagcaagaacctttcaagatatagttgatattttgcaaaaagagttaaag
actgatttgccttgtgaatatatcccaaatccttatgtaaaatcttatcaattccatact
gaagcaaaactagatcaaacttgggattatcagccaaaatttagtcttgaagaggggatt
aaagattatttagatgagataaaaagactttttgaaaaggaagtaaatgcttga

DBGET integrated database retrieval system