KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0523Help
Entry
CJS3_0523         CDS       T01856                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00020  Citrate cycle (TCA cycle)
cjs00640  Propanoate metabolism
cjs00660  C5-Branched dibasic acid metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
cjs01200  Carbon metabolism
Module
cjs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJS3_0523 (sucC)
   00640 Propanoate metabolism
    CJS3_0523 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CJS3_0523 (sucC)
Enzymes [BR:cjs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJS3_0523 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF1983 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADT72280
Position
497338..498501
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAIFVDNGIPTLKGKVAFSVDEAVANAKELGGSVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQ
ITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEVARVLGLDKDEGKKLISM
IAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDTTEENP
AEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASPETVAK
AFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTI
LDNSNLKNIKAATNLKNGAELVKSLVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgagtatcaagcaaaagcaatttttgtagacaatggcatccctacctta
aagggaaaagttgcatttagcgtagatgaagctgtggctaatgctaaagaattaggcggt
agtgtttgggcagttaaagctcaaattcatgcaggaggccgtggtcttggtggtggtgtt
aaaatcgctaagaatttagatgaggtaaaagattatgcaagtaaaattttaggaatgaat
ttagtaactcatcaaacaggacctgaaggcaaacttgtgcaaaaactttatatagaaagt
ggtgctaatatagtaaaagagtattatttggctattttgtttaatagaatggcagagcaa
attaccattatcgcttcaagtgaaggagggatggatatagaaaaagtagccaaagaaagt
cctgaaaaaattgcaaaagtaggtattgatccacaaattggatttaaaatgtttcatgga
cttgaagtagcgagagttttgggacttgataaagatgaaggcaaaaaactcatttctatg
atagctaaactttataagctttacatggataaagatatgaatatgcttgaaattaatcct
ttaattaaaactgcagaaggggatttttatgcccttgatgcaaaatgcagttttgatgat
agtgcgctttatcgtcatcctgaaattgctgaacttagagatactactgaagaaaatcct
gctgaaagagaagcggctgaatttggcttaagctatgtgaaattagatggagatgtagct
tgtatggtaaatggtgcgggtctagcaatggcaactatggatattattaattatagtggt
gcaaaacctgcaaatttcttagatgtaggtgggggagcttctccagaaactgttgcaaag
gcttttgaaattattttaagagataaaaatgtaaaagttatatttatcaatatctttggt
ggtattgttcgttgtgataggatagcaaatggaattttagaagctactaagaatgttgag
gtaaatattccaattgtagtgcgtcttgatggcactaacgcagcagaagcaaagacaatt
ttagataattcaaatcttaaaaatatcaaagcagcaaccaatcttaaaaacggtgcagag
cttgtaaaaagtttagtaggataa

DBGET integrated database retrieval system