KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0844Help
Entry
CJS3_0844         CDS       T01856                                 

Definition
(GenBank) 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 FSH1 Lipase_3 Abhydrolase_4 Rota_VP2 Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: ADT72579
Position
complement(780174..780893)
Genome map
AA seq 239 aa AA seqDB search
MAQTQLSYKNKTYQISYEILGDLTLPQILILHGWGANKELMKQSFYPFLKDFCQIYMDLA
GFGNSSVEEILNTQDYANITELFLKQKKLNVCFFMGHSFGGKVSTLLAKEKDTLILLSSA
GILAKKSLKVRFKIRIFKILKLFGLGKFYRYFASKDGANLSPMMYETFKNVVDEDFGEIF
AKQKAKSLVFWGKSDEATPLYCGEKMHQLLKNSTFYPLEGDHFFFLKYSAFIAQKIKEI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaactcaactttcttataaaaacaaaacttatcaaatttcttatgaaatttta
ggtgatcttaccttaccgcaaatacttatcttacacggctggggagccaataaagaactt
atgaagcaaagtttttatccttttttgaaagacttttgtcaaatttatatggatttggcg
ggttttggaaattcaagtgtggaagaaattttaaacactcaagattatgccaatatcaca
gaactttttttaaaacaaaaaaaactcaatgtctgttttttcatggggcattcttttggt
ggaaaagtaagcaccctactcgcaaaagaaaaagacaccctaatcttactttcaagtgca
ggaattttagctaaaaaatccctaaaagtgcgttttaaaatccgtatttttaaaatttta
aaactctttggtttgggaaaattttatcgctattttgctagtaaagatggagcaaatctt
agccctatgatgtatgaaacctttaaaaatgttgttgatgaggattttggtgaaattttt
gccaagcaaaaggctaaaagcttggttttttggggaaaaagcgatgaagccacgcctttg
tattgtggtgaaaaaatgcatcaacttttaaaaaatagcactttttatcctttagagggg
gatcattttttctttttaaaatattctgctttcatagctcaaaaaattaaggaaatttaa

DBGET integrated database retrieval system