KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0845Help
Entry
CJS3_0845         CDS       T01856                                 

Definition
(GenBank) Hypothetical protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhdYeFM_antitox
Motif
Other DBs
NCBI-ProteinID: ADT72580
Position
complement(780895..781110)
Genome map
AA seq 71 aa AA seqDB search
MLSFKQDEIYTATEVVRNFSPIMEKLKKSESGKIVILKNNKFEAVMLSMKEFERLQNAMQ
LLENIYKNQKA
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgctctcttttaaacaagatgaaatttacactgccaccgaagtggtaagaaattttagc
cccattatggaaaaactcaaaaaaagcgaaagtggaaaaatagttattttaaaaaataac
aaatttgaagctgtaatgcttagcatgaaggaatttgaacgcttacaaaacgccatgcaa
cttttagaaaatatctacaaaaatcaaaaggcttaa

DBGET integrated database retrieval system