KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0852Help
Entry
CJS3_0852         CDS       T01856                                 

Gene name
pyrD
Definition
(GenBank) Dihydroorotate dehydrogenase
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00240  Pyrimidine metabolism
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CJS3_0852 (pyrD)
Enzymes [BR:cjs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     CJS3_0852 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHO_dh ThiI
Motif
Other DBs
NCBI-ProteinID: ADT72587
Position
789316..790374
Genome map
AA seq 352 aa AA seqDB search
MAYEMIKPLLFKLNPEHVHTLVEYSLRALSASFPGSLSFLAHKYIVDDESLRQNLLGLDF
NNPVGLAGGFDKNATMIRPLSALGFGFLEVGTFTPKPQEGNEKPRLFRLVKQESIQNAMG
FNNEGAEKIALRLVKTYPFVLPLGVNIGKNKITPNDKALEDYFTLFRDFKDLCDYFIVNI
SSPNTKNLRELQNDDFLNTLLEEAKKITSKPILIKIAPDMKIDDALNLCENAIKKGADGF
ILANTSVDYSLLDNNRTFGGISGRLITEKSGIFFKEVAKILFGKTLLIASGGIDSADIAY
ERIKNGANLVQVYTALIFKGPSLVKNINQNLIELLRKDGFLHISEAVGVNLK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaaatgataaaacctttactttttaagttaaaccctgagcatgtacatact
ttggttgaatatagcttaagagctttaagtgctagttttccaggatctttaagtttttta
gcacataaatatatagttgatgatgagagtttaaggcaaaatttacttggacttgatttt
aataatcctgtgggtttagcagggggctttgataaaaatgccactatgataagacctttg
agtgctttaggatttggctttttggaagtgggaacttttactccaaaacctcaagaaggc
aatgaaaaaccacgcctatttagacttgtaaaacaagaaagtatacaaaatgctatgggt
tttaacaacgaaggtgctgaaaagatcgctttaagacttgtaaaaacttatcctttcgtt
ttacctttaggggtaaatatagggaaaaataaaatcactccaaatgacaaagctttggag
gattattttactttatttagagattttaaggatttgtgtgattattttatcgttaatatc
tcatctcctaatactaaaaatttaagagagttacaaaatgatgattttttaaataccttg
cttgaagaagccaaaaaaattacttctaagcctattttgataaaaattgctcctgatatg
aaaatagatgatgctttaaatttatgtgaaaatgctattaaaaaaggtgcagatgggttt
atattagccaatactagtgttgattatagcttactagataataatcgtacttttggtggt
attagtggaaggttgattacagaaaaaagtggtatttttttcaaagaagtagctaaaatt
ctttttggcaaaaccttgcttattgcaagtggagggattgatagtgctgatattgcttat
gagcgtattaaaaatggggctaatttggtgcaagtttatacagctttgatttttaaaggt
ccttctttggtaaaaaatatcaatcaaaatcttatagagcttttaagaaaagatggtttt
ttacacattagcgaagctgttggggtaaatttaaaatga

DBGET integrated database retrieval system