KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0856Help
Entry
CJS3_0856         CDS       T01856                                 

Definition
(GenBank) Small hydrophobic protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADT72591
Position
complement(793330..793635)
Genome map
AA seq 101 aa AA seqDB search
MELDQILLYAFIFLNLFALFGLFLGNKKKNQFNDKKFYKICPCKKMAENGSLSTICIYSA
VGGFFYSVLSIGFIGFGNWTLNFIFLLALLSVFLGWKLKLD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggaattagatcaaattttattatatgcttttatttttttaaatctttttgcccttttt
ggtttatttttgggaaataaaaagaaaaatcaatttaatgataaaaaattttataaaatc
tgcccatgtaaaaaaatggcagaaaatggatctttaagtacgatttgtatttattcagct
gtaggaggatttttttacagcgtattatctataggttttataggttttggtaattggact
ttaaattttatttttttacttgcattattaagtgtttttttagggtggaaattaaaactt
gattga

DBGET integrated database retrieval system