KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0859Help
Entry
CJS3_0859         CDS       T01856                                 

Gene name
lpxK
Definition
(GenBank) Tetraacyldisaccharide 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00540  Lipopolysaccharide biosynthesis
cjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CJS3_0859 (lpxK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cjs01005]
    CJS3_0859 (lpxK)
Enzymes [BR:cjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.130  tetraacyldisaccharide 4'-kinase
     CJS3_0859 (lpxK)
Lipopolysaccharide biosynthesis proteins [BR:cjs01005]
 Lipid A
  CJS3_0859 (lpxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxK AAA
Motif
Other DBs
NCBI-ProteinID: ADT72594
Position
795061..795987
Genome map
AA seq 308 aa AA seqDB search
MNEEKNYELWLDNYFFKPNFWQKCLAFILLPLSVLYAFFAILNTFFRKKIVFKKPVISVG
NLSFGGNGKTPLCKAIAREFDGVFIVLRGYKRKSKGLFVVKNQNEILCTLVQSGDEAMEY
AFEENIKGVIVSEDRVKGIEKAFELGAKIVVLDDAFSKFHIKKFDILLESKIKPYFDFTL
PSGAYRLPKFYEKRADFIALEGRDFVRYSFVKENPKAVLATAIAKPFRLYEHFIKARACY
FFKDHYEFKKEELENLLKKHNCDTLMLTFKDFVKVKDFGFKCQIIELNIELKDSLREKIK
TYIKEFEQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaaaaaattatgaactttggcttgataattatttttttaagcccaatttt
tggcaaaaatgccttgcttttatacttttacctttaagtgtgctttatgctttttttgcg
attttaaatactttttttcgtaaaaaaatagtttttaaaaagcctgttattagcgttggt
aatttaagttttggaggtaatggaaaaaccccgctttgtaaagctatagcaagggaattt
gatggcgtttttatagtacttaggggctataaaagaaagtctaaaggtttgtttgttgtt
aaaaatcaaaatgaaattttatgcaccttagtacaaagtggcgatgaagctatggagtat
gcttttgaagaaaatatcaaaggtgtgattgtgagtgaagatagagtaaaaggtattgaa
aaagcctttgaattgggagctaaaatcgttgtactcgatgatgctttttctaaatttcat
attaaaaaatttgatattttgcttgaaagcaaaatcaaaccttattttgattttacttta
ccaagtggagcttatcgtttgccaaaattttatgaaaaaagggctgattttattgcatta
gaaggcagggattttgtgcgttattcttttgtaaaagaaaatccaaaggctgttttggca
actgctattgctaaaccttttagattgtatgagcattttatcaaagcaagggcttgttat
ttttttaaagatcattatgagtttaaaaaagaagaattagaaaatttgctaaaaaaacat
aattgcgatacactaatgcttacttttaaggattttgttaaagttaaagattttggtttt
aaatgtcaaattatagaattaaatatagaattaaaagattcattaagggaaaaaataaaa
acttatatcaaggagtttgagcaatga

DBGET integrated database retrieval system