KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0860Help
Entry
CJS3_0860         CDS       T01856                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00260  Glycine, serine and threonine metabolism
cjs00750  Vitamin B6 metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01230  Biosynthesis of amino acids
Module
cjs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJS3_0860 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CJS3_0860 (thrC)
Enzymes [BR:cjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CJS3_0860 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N CbiA
Motif
Other DBs
NCBI-ProteinID: ADT72595
Position
795984..797396
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNKIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNVNNILSEFFNHGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEAKNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtcgagagtagaaatgtaaataatgtatcaagttttaaggaagctttgatt
aacccaaacgccccagaaggagggctttactcgcctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagcgaa
ttttcaaaggataaaaatattttaattatttgtgctacgagcggcgatacaggacctgca
accctaaaaagctttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataatttgaaagtt
tttgctatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaacaaaattaaagctttaaattatgagctttgcgcagcgaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcattgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaat
gtgaataatattttgagtgaattttttaatcatggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaaccaaagaactgatgaatttgttgaaaaatgag
agatattttaaacttgaaaaagaagaattgcaaagtttacaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatcgatccg
cacaccgcaacttgttttaaaatgcttgatcctttaaaacctagcattattacctctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatacgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttggctttatttgacttgaaaaatagcgatgaaaaggtatttgaagccaaaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system