KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0862Help
Entry
CJS3_0862         CDS       T01856                                 

Definition
(GenBank) hypothetical protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPC25 CooC_C
Motif
Other DBs
NCBI-ProteinID: ADT72597
Position
798199..799446
Genome map
AA seq 415 aa AA seqDB search
MSIFSINDNSNYGSILSQAKANKESKENSKISFTNAFLKQNASKLNEIQNANSQTLARSE
VLNSTNTTNTSNNTNFSISSKTSSPNYDISSEFKNSIYTLKYKQTDLSTDTAYGYSVDKD
GYMGSDFNKAAGLPEDFKIHKSTLDEIERFNQHNMASETSGNYYDSFDMASIVKSYYNSF
NQVISAFPNDKTSFSEADLEQLPKGLNDGCNENKEYIVTHIFNAEQFHEAQAIKYSTMNL
GMNLMKLDFSPQSMEQGPSNEGEFNPDMSVYPQNEDGSYSKEALFMSFLKSYSPIPSPNQ
VVFSPEAKVLEAKFEQEMKANPSFDVSLDDIMTGKVDFASLLKGYAQDGWLDADIYAMEK
GVAWQNTSIGYGGAWFDNQFNQAKANGWKASSESINSYVGSIMDRLNNLIGQTRV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctttagcatcaatgataactcaaactatggttctatactttcacaagcaaaa
gctaataaagaaagtaaagaaaattctaaaataagttttactaatgcttttttaaaacaa
aatgctagtaaattaaatgaaattcaaaatgcaaattcacaaactctagcaagaagtgaa
gtattaaattctactaatacaacaaataccagcaataatactaattttagtataagtagt
aagacaagttctcctaactatgatatatcaagtgaatttaaaaactctatttatactcta
aaatataaacaaacagatttaagcactgatacagcctatggttatagtgtagataaagat
ggttatatgggaagtgattttaacaaagccgcaggattacctgaagattttaagatacat
aaatctactttggatgagatagagagatttaatcaacataatatggctagtgaaaccagt
ggaaactattatgatagttttgatatggcttctattgttaaatcctattataatagcttt
aatcaagtaataagtgcatttccaaatgataaaacaagttttagcgaagctgatttagag
caattaccaaaaggactaaatgatggttgcaatgaaaacaaagaatatattgtaacacat
atatttaacgcagaacaatttcacgaagcacaagcgattaagtattctactatgaatttg
ggtatgaaccttatgaaacttgacttttctccacaaagcatggagcaaggaccttcaaat
gaaggtgaatttaatcctgatatgtcagtttatccacaaaatgaagatggaagttattct
aaagaagctttatttatgagttttttaaagtcttattcgcctattccatctccaaatcaa
gttgtttttagtcctgaagcaaaagttttagaagcaaaatttgagcaagaaatgaaagca
aatccttctttcgatgtttcactagatgacattatgacaggcaaagttgattttgcaagt
ttgttaaaaggttatgcacaagatggctggcttgatgcagatatatatgcaatggaaaaa
ggagttgcttggcaaaatacaagtataggctatggtggagcttggtttgataatcagttt
aatcaagcaaaggctaatggctggaaagcaagcagtgaaagtataaattcttatgttggt
tctataatggatagattaaataatcttataggacaaactagggtttag

DBGET integrated database retrieval system