KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0867Help
Entry
CJS3_0867         CDS       T01856                                 

Definition
(GenBank) hypothetical protein
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADT72602
Position
803641..804258
Genome map
AA seq 205 aa AA seqDB search
MSMINSTLPIQMKVLAKSGYGHYTLLLNHKKIQTKSMIELEIGAEYLAELYMQNGGVIQF
KHLSKRPNFKPFEEGLALIIAMLEDKISYKKFIIQNLLDCKDIERYQILKEMLFASFENI
YHIPFNFENKSCLFQMRKRAKYLEIYLYFSVFGALKILIDSQGISVFTPFAKVQKFLNEH
LDFNVSQENKIEPLFVFKRLFDFKG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgattaattctaccttacctatacaaatgaaagttttagctaaatcaggttat
ggacattatacgcttttattaaatcataaaaagattcaaaccaaaagcatgatagagctt
gaaattggtgctgaatatttagctgaactttatatgcaaaatggtggagttatacaattt
aaacatctttcaaagcgtcctaattttaaaccttttgaagagggattggctttgataatc
gctatgttagaggataaaatttcttataaaaaattcattatacaaaatcttttagattgt
aaagatatagagcgttatcagatattaaaagaaatgctttttgcaagttttgaaaatatt
tatcatattccttttaactttgaaaataaatcttgcttgtttcaaatgcgtaaaagagca
aaatatttagaaatttacttatattttagtgtttttggagctttaaaaattttaatagac
tcgcaaggcattagtgtttttacaccttttgccaaggtgcaaaaatttttaaacgaacat
ttagattttaatgtatcgcaagaaaacaagattgaacctttgtttgttttcaaaaggctt
tttgattttaaaggatga

DBGET integrated database retrieval system