KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0868Help
Entry
CJS3_0868         CDS       T01856                                 

Definition
(GenBank) Undecaprenyl pyrophosphate synthetase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00900  Terpenoid backbone biosynthesis
cjs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CJS3_0868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cjs01006]
    CJS3_0868
Enzymes [BR:cjs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     CJS3_0868
Prenyltransferases [BR:cjs01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CJS3_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf XylR_N
Motif
Other DBs
NCBI-ProteinID: ADT72603
Structure
PDB: 

Position
804262..804930
Genome map
AA seq 222 aa AA seqDB search
MNELKHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISNLSLFAFSTEN
WKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHC
DALCVNLAISYGARDEIIRAAKRVIEKKLELNEENLTQNLDLPLDVDLMLRVGNAKRLSN
FLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattaaaacatcttgctgttgttatggatggcaataggcgctgggctagagct
aagggttttttggcaaagcttggatattcccaaggagtcaaaactatgcaaaaattgatg
gaagtttgcatggaagaaaatatttcaaatttaagcctttttgcttttagtacggaaaat
tggaagcgtcctaaagatgaaattgattttatctttgaacttttagatcgttgtttagat
gaagctttagaaaaatttgaaaaaaataatgtgcgtttaagagctataggtgatttatcg
cgcttggaagataaagtaagagaaaaaattaccttagttgaagaaaaaacaaagcattgt
gacgcactttgtgttaatttggctataagttatggtgcaagagatgagattataagagct
gctaagcgtgtgattgaaaaaaaacttgagctaaatgaagaaaatttaacgcaaaattta
gatttacctttagatgtggatttgatgcttcgcgttggaaacgctaaaagactttcaaat
ttcttactttggcagtgttcatatgctgaaatttattttagtgaaactttatttccatct
cttaccaagagagaatttaaaaggattattaaagaatttagaaatagagaaagaactttt
ggaaaatga

DBGET integrated database retrieval system