KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0891Help
Entry
CJS3_0891         CDS       T01856                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00564  Glycerophospholipid metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
Module
cjs_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cjs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJS3_0891 (psd)
Enzymes [BR:cjs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CJS3_0891 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase ERO1
Motif
Other DBs
NCBI-ProteinID: ADT72626
Position
826734..827534
Genome map
AA seq 266 aa AA seqDB search
MSFSKESSRLFGFVAGIKFPKMIQKVINENYVKYFNIDMSEFKSSCEYESLNALFTRTLQ
IPRKLEEGFISPSDGKILECGSTFLANEEHFAFSIKGHTYSIEELLKDSFEKDELKNGLD
YVNIYLSPKDYHRYHSPCDMQILSATYTSGVLYSVNEKHLERISNLYVKNERVSLKCQNE
KGIFWLVFVGAQNVGKMRFNFDASIQTNAKISHNFTRKYENLNFKKGEELGNFELGSTIV
LISQKGLLTFNLKVGQGIKFGEKIAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcaaaagaaagttcgagactttttggttttgtagcggggattaaatttcct
aaaatgatacaaaaagttattaatgaaaattatgttaagtattttaatatcgatatgagt
gaatttaaaagctcttgtgaatacgagagtttaaatgctctttttacaagaactttgcaa
attccaagaaagcttgaagaaggttttatcagtccaagtgatggtaaaattttagagtgt
ggaagtacttttttggcaaatgaagaacattttgctttttctataaaaggacatacttat
agcattgaggagcttttaaaagatagctttgaaaaagatgagcttaaaaatgggcttgat
tatgtcaatatttatctttctccaaaagattatcatcgttatcacagcccttgtgatatg
caaattttaagtgcaacttacacaagtggagtgctttatagcgtaaatgaaaaacattta
gaacgcattagtaatttatatgtaaaaaatgaaagagtgagcttgaaatgtcaaaatgaa
aaaggtattttttggcttgtttttgtaggagcgcaaaatgtaggaaaaatgcgttttaat
tttgatgcaagcatacaaaccaatgctaaaatttctcataattttactagaaaatatgaa
aatttaaatttcaaaaaaggcgaagaactaggaaattttgagctaggttctactatagtt
ttaatctctcaaaaaggacttttaacttttaatttaaaagtagggcagggtattaaattt
ggagaaaaaatagcggattag

DBGET integrated database retrieval system